Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-mazE/PIN(toxin) |
Location | 719922..720714 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | MR221_RS03480 | Protein ID | WP_003403386.1 |
Coordinates | 719922..720359 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TQE0 |
Locus tag | MR221_RS03485 | Protein ID | WP_003403381.1 |
Coordinates | 720469..720714 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS03455 | 716385..716558 | - | 174 | WP_003898549.1 | hypothetical protein | - |
MR221_RS03460 | 716555..716893 | - | 339 | WP_003403405.1 | PIN domain-containing protein | - |
MR221_RS03465 | 716805..717131 | - | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR221_RS03470 | 717194..719557 | - | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
MR221_RS03475 | 719671..719925 | + | 255 | WP_003911263.1 | antitoxin VapB7 | - |
MR221_RS03480 | 719922..720359 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS03485 | 720469..720714 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MR221_RS03490 | 720701..721009 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
MR221_RS03495 | 721285..722001 | + | 717 | WP_003903122.1 | CPBP family intramembrane metalloprotease | - |
MR221_RS03500 | 722077..722232 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR221_RS03505 | 722327..722710 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
MR221_RS03510 | 723098..724108 | - | 1011 | WP_031653722.1 | ABC transporter ATP-binding protein | - |
MR221_RS03515 | 724189..725694 | - | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T295090 WP_003403386.1 NZ_OW052188:719922-720359 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQE0 |