Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 633623..634332 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4F979 |
Locus tag | MR221_RS03005 | Protein ID | WP_003903160.1 |
Coordinates | 633623..634051 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TEX4 |
Locus tag | MR221_RS03010 | Protein ID | WP_003403834.1 |
Coordinates | 634075..634332 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS02975 | 629326..630858 | + | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
MR221_RS02980 | 630865..632037 | + | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
MR221_RS02985 | 632048..632932 | + | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
MR221_RS02990 | 633001..633246 | - | 246 | WP_003403841.1 | hypothetical protein | - |
MR221_RS03000 | 633405..633542 | + | 138 | WP_003403839.1 | hypothetical protein | - |
MR221_RS03005 | 633623..634051 | - | 429 | WP_003903160.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS03010 | 634075..634332 | - | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MR221_RS03015 | 634423..637212 | - | 2790 | WP_031653738.1 | PE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15799.21 Da Isoelectric Point: 7.5536
>T295088 WP_003903160.1 NZ_OW052188:c634051-633623 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLVLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLVLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F979 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TEX4 |