Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 461190..461809 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | MR221_RS02165 | Protein ID | WP_003404726.1 |
Coordinates | 461190..461624 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
Locus tag | MR221_RS02170 | Protein ID | WP_003404724.1 |
Coordinates | 461630..461809 (-) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS02140 | 456525..457763 | + | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
MR221_RS02145 | 457765..459273 | + | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
MR221_RS02150 | 459440..459670 | + | 231 | WP_003898642.1 | hypothetical protein | - |
MR221_RS02155 | 459805..460254 | - | 450 | WP_003404738.1 | hypothetical protein | - |
MR221_RS02160 | 460319..461092 | - | 774 | WP_003404735.1 | VOC family protein | - |
MR221_RS02165 | 461190..461624 | - | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
MR221_RS02170 | 461630..461809 | - | 180 | WP_003404724.1 | antitoxin | Antitoxin |
MR221_RS02175 | 461935..462093 | - | 159 | WP_003404720.1 | hypothetical protein | - |
MR221_RS02180 | 462366..464759 | - | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
MR221_RS02185 | 464756..466336 | - | 1581 | WP_003909313.1 | serine hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T295087 WP_003404726.1 NZ_OW052188:c461624-461190 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|