Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 246755..247386 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | MR221_RS01115 | Protein ID | WP_003405820.1 |
Coordinates | 247075..247386 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | MR221_RS01110 | Protein ID | WP_003405836.1 |
Coordinates | 246755..247075 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS01085 | 241951..242589 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
MR221_RS01090 | 242586..243833 | + | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
MR221_RS01095 | 243823..244080 | + | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
MR221_RS01100 | 244090..245202 | + | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
MR221_RS01105 | 245209..246745 | - | 1537 | Protein_219 | carboxylesterase/lipase family protein | - |
MR221_RS01110 | 246755..247075 | + | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
MR221_RS01115 | 247075..247386 | + | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
MR221_RS01120 | 247498..248655 | + | 1158 | WP_003898727.1 | AI-2E family transporter | - |
MR221_RS01125 | 248662..249306 | - | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
MR221_RS01130 | 249362..250453 | + | 1092 | WP_242363202.1 | class II fructose-bisphosphatase | - |
MR221_RS01135 | 250484..251908 | + | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T295084 WP_003405820.1 NZ_OW052188:247075-247386 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |