Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 238062..238630 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag MR221_RS01060 Protein ID WP_003405865.1
Coordinates 238062..238436 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag MR221_RS01065 Protein ID WP_003405863.1
Coordinates 238433..238630 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS01025 234412..235182 + 771 Protein_203 adenylate/guanylate cyclase domain-containing protein -
MR221_RS01030 235134..235343 - 210 WP_003911400.1 hypothetical protein -
MR221_RS01035 235377..236075 + 699 WP_031646953.1 hypothetical protein -
MR221_RS01040 236090..236413 - 324 WP_003405871.1 putative quinol monooxygenase -
MR221_RS01045 236656..236931 + 276 WP_003405867.1 hypothetical protein -
MR221_RS01050 236858..237043 - 186 WP_003901093.1 hypothetical protein -
MR221_RS01055 237161..237859 - 699 WP_003898733.1 hypothetical protein -
MR221_RS01060 238062..238436 - 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
MR221_RS01065 238433..238630 - 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR221_RS01070 238718..239791 - 1074 WP_003898732.1 redox-regulated ATPase YchF -
MR221_RS01075 239854..240837 + 984 WP_003903326.1 hypothetical protein -
MR221_RS01080 240854..241861 - 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
MR221_RS01085 241951..242589 + 639 WP_003898730.1 lipid droplet-associated protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T295083 WP_003405865.1 NZ_OW052188:c238436-238062 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT295083 WP_003405863.1 NZ_OW052188:c238630-238433 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References