Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 88802..89361 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0THS1 |
Locus tag | MR221_RS00380 | Protein ID | WP_003898789.1 |
Coordinates | 89068..89361 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0THS2 |
Locus tag | MR221_RS00375 | Protein ID | WP_003406322.1 |
Coordinates | 88802..89071 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS00365 | 83952..84740 | + | 789 | WP_003406325.1 | hypothetical protein | - |
MR221_RS00370 | 84882..88577 | + | 3696 | WP_015631286.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
MR221_RS00375 | 88802..89071 | + | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR221_RS00380 | 89068..89361 | + | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
MR221_RS00385 | 89418..90248 | + | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
MR221_RS00390 | 90329..91189 | - | 861 | WP_003903377.1 | glycine betaine ABC transporter substrate-binding protein | - |
MR221_RS00395 | 91369..93054 | + | 1686 | WP_031719099.1 | PE family protein | - |
MR221_RS00400 | 93077..93508 | - | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS00405 | 93505..93765 | - | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T295081 WP_003898789.1 NZ_OW052188:89068-89361 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|