Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 3572594..3573287 | Replicon | chromosome |
| Accession | NZ_OW011623 | ||
| Organism | Thauera sp. PIV-1 strain Piv1 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | QM552_RS16580 | Protein ID | WP_282811068.1 |
| Coordinates | 3572594..3572971 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | QM552_RS16585 | Protein ID | WP_282811069.1 |
| Coordinates | 3572952..3573287 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM552_RS16570 (C4PIVTH_3487) | 3568870..3571818 | - | 2949 | WP_282811066.1 | Tn3 family transposase | - |
| QM552_RS16575 (C4PIVTH_3488) | 3571823..3572413 | - | 591 | WP_282811067.1 | recombinase family protein | - |
| QM552_RS16580 (C4PIVTH_3489) | 3572594..3572971 | + | 378 | WP_282811068.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM552_RS16585 (C4PIVTH_3490) | 3572952..3573287 | + | 336 | WP_282811069.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QM552_RS16590 (C4PIVTH_3491) | 3573301..3573660 | + | 360 | WP_282811070.1 | transposase | - |
| QM552_RS16595 (C4PIVTH_3492) | 3573657..3573881 | + | 225 | WP_282811071.1 | hypothetical protein | - |
| QM552_RS16600 | 3574075..3574227 | + | 153 | WP_282811691.1 | hypothetical protein | - |
| QM552_RS16605 (C4PIVTH_3494) | 3574506..3576110 | - | 1605 | WP_282811072.1 | IS66 family transposase | - |
| QM552_RS16610 (C4PIVTH_3495) | 3576207..3576545 | - | 339 | WP_282811073.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QM552_RS16615 (C4PIVTH_3496) | 3576545..3576877 | - | 333 | WP_282811074.1 | hypothetical protein | - |
| QM552_RS16620 (C4PIVTH_3497) | 3576955..3577818 | + | 864 | Protein_3262 | Tn3 family transposase | - |
| QM552_RS16625 (C4PIVTH_3498) | 3577855..3578166 | + | 312 | Protein_3263 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 3571823..3578202 | 6379 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13774.90 Da Isoelectric Point: 8.8594
>T295079 WP_282811068.1 NZ_OW011623:3572594-3572971 [Thauera sp. PIV-1]
MVEKEKPLEWIASSYKDLMTLPPDVRRRFGYALSLAQMGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEALAQELRNAKTNH
MVEKEKPLEWIASSYKDLMTLPPDVRRRFGYALSLAQMGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEALAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|