Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 3512137..3512740 Replicon chromosome
Accession NZ_OW011623
Organism Thauera sp. PIV-1 strain Piv1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QM552_RS16365 Protein ID WP_282811044.1
Coordinates 3512137..3512502 (-) Length 122 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QM552_RS16370 Protein ID WP_282811045.1
Coordinates 3512489..3512740 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QM552_RS16340 (C4PIVTH_3435) 3507175..3507378 + 204 WP_048709377.1 YjfB family protein -
QM552_RS16345 (C4PIVTH_3437) 3507589..3507909 - 321 WP_282811040.1 hypothetical protein -
QM552_RS16350 (C4PIVTH_3438) 3507931..3508395 - 465 WP_282811041.1 type IV pilin protein -
QM552_RS16355 (C4PIVTH_3439) 3508417..3510864 - 2448 WP_282811042.1 PilC/PilY family type IV pilus protein -
QM552_RS16360 (C4PIVTH_3441) 3511135..3512103 + 969 WP_282811043.1 IS1595 family transposase -
QM552_RS16365 (C4PIVTH_3442) 3512137..3512502 - 366 WP_282811044.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QM552_RS16370 (C4PIVTH_3443) 3512489..3512740 - 252 WP_282811045.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QM552_RS16375 (C4PIVTH_3444) 3512829..3513782 - 954 WP_282811046.1 hypothetical protein -
QM552_RS16380 (C4PIVTH_3445) 3513818..3514306 - 489 WP_282811047.1 PilX N-terminal domain-containing pilus assembly protein -
QM552_RS16385 (C4PIVTH_3446) 3514318..3515274 - 957 WP_282811048.1 PilW family protein -
QM552_RS16390 (C4PIVTH_3447) 3515271..3515879 - 609 WP_282811049.1 type IV pilus modification protein PilV -
QM552_RS16395 (C4PIVTH_3448) 3515888..3516574 - 687 WP_282811050.1 GspH/FimT family pseudopilin -
QM552_RS16400 (C4PIVTH_3451) 3517059..3517718 + 660 WP_282811051.1 TIGR02281 family clan AA aspartic protease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3507175..3519429 12254


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(17-92)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-76)


Sequences

Toxin        


Download         Length: 122 a.a.        Molecular weight: 13961.35 Da        Isoelectric Point: 10.3533

>T295078 WP_282811044.1 NZ_OW011623:c3512502-3512137 [Thauera sp. PIV-1]
MTKSEPSRKYKYRLFFIPSALQEWRDLDGSVKEPLRKLLRKRLNNPHVPGGALHGELEGYYKIKLRKQGYRLVYGVEDDA
LIVMVMAVDKREDGAVYRSVLARLAEKATELAKAVKERLIT

Download         Length: 366 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9486.90 Da        Isoelectric Point: 4.4488

>AT295078 WP_282811045.1 NZ_OW011623:c3512740-3512489 [Thauera sp. PIV-1]
MQTILTDITVSMSEFKKNPAYVLREANSRPVAVLNHNKAAFYMVEPKLFQAMVEELADQDLYRTVLARVAEKEQAVEVDI
DEI

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References