Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3512137..3512740 | Replicon | chromosome |
| Accession | NZ_OW011623 | ||
| Organism | Thauera sp. PIV-1 strain Piv1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QM552_RS16365 | Protein ID | WP_282811044.1 |
| Coordinates | 3512137..3512502 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QM552_RS16370 | Protein ID | WP_282811045.1 |
| Coordinates | 3512489..3512740 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM552_RS16340 (C4PIVTH_3435) | 3507175..3507378 | + | 204 | WP_048709377.1 | YjfB family protein | - |
| QM552_RS16345 (C4PIVTH_3437) | 3507589..3507909 | - | 321 | WP_282811040.1 | hypothetical protein | - |
| QM552_RS16350 (C4PIVTH_3438) | 3507931..3508395 | - | 465 | WP_282811041.1 | type IV pilin protein | - |
| QM552_RS16355 (C4PIVTH_3439) | 3508417..3510864 | - | 2448 | WP_282811042.1 | PilC/PilY family type IV pilus protein | - |
| QM552_RS16360 (C4PIVTH_3441) | 3511135..3512103 | + | 969 | WP_282811043.1 | IS1595 family transposase | - |
| QM552_RS16365 (C4PIVTH_3442) | 3512137..3512502 | - | 366 | WP_282811044.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM552_RS16370 (C4PIVTH_3443) | 3512489..3512740 | - | 252 | WP_282811045.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QM552_RS16375 (C4PIVTH_3444) | 3512829..3513782 | - | 954 | WP_282811046.1 | hypothetical protein | - |
| QM552_RS16380 (C4PIVTH_3445) | 3513818..3514306 | - | 489 | WP_282811047.1 | PilX N-terminal domain-containing pilus assembly protein | - |
| QM552_RS16385 (C4PIVTH_3446) | 3514318..3515274 | - | 957 | WP_282811048.1 | PilW family protein | - |
| QM552_RS16390 (C4PIVTH_3447) | 3515271..3515879 | - | 609 | WP_282811049.1 | type IV pilus modification protein PilV | - |
| QM552_RS16395 (C4PIVTH_3448) | 3515888..3516574 | - | 687 | WP_282811050.1 | GspH/FimT family pseudopilin | - |
| QM552_RS16400 (C4PIVTH_3451) | 3517059..3517718 | + | 660 | WP_282811051.1 | TIGR02281 family clan AA aspartic protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3507175..3519429 | 12254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13961.35 Da Isoelectric Point: 10.3533
>T295078 WP_282811044.1 NZ_OW011623:c3512502-3512137 [Thauera sp. PIV-1]
MTKSEPSRKYKYRLFFIPSALQEWRDLDGSVKEPLRKLLRKRLNNPHVPGGALHGELEGYYKIKLRKQGYRLVYGVEDDA
LIVMVMAVDKREDGAVYRSVLARLAEKATELAKAVKERLIT
MTKSEPSRKYKYRLFFIPSALQEWRDLDGSVKEPLRKLLRKRLNNPHVPGGALHGELEGYYKIKLRKQGYRLVYGVEDDA
LIVMVMAVDKREDGAVYRSVLARLAEKATELAKAVKERLIT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|