Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1853053..1853590 | Replicon | chromosome |
| Accession | NZ_OW011623 | ||
| Organism | Thauera sp. PIV-1 strain Piv1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QM552_RS08385 | Protein ID | WP_282810000.1 |
| Coordinates | 1853053..1853355 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QM552_RS08390 | Protein ID | WP_048706619.1 |
| Coordinates | 1853345..1853590 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM552_RS08345 (C4PIVTH_1741) | 1849096..1849536 | - | 441 | WP_282809994.1 | hypothetical protein | - |
| QM552_RS08350 (C4PIVTH_1742) | 1849564..1849743 | - | 180 | WP_282809995.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| QM552_RS08355 (C4PIVTH_1743) | 1849971..1850231 | - | 261 | WP_282809996.1 | hypothetical protein | - |
| QM552_RS08360 (C4PIVTH_1744) | 1850245..1850622 | - | 378 | WP_282809997.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QM552_RS08365 (C4PIVTH_1745) | 1850619..1850906 | - | 288 | WP_004291581.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QM552_RS08370 (C4PIVTH_1747) | 1850982..1851131 | - | 150 | WP_282811637.1 | hypothetical protein | - |
| QM552_RS08375 (C4PIVTH_1748) | 1851289..1851561 | - | 273 | WP_282809998.1 | nucleotidyltransferase domain-containing protein | - |
| QM552_RS08380 (C4PIVTH_1749) | 1851685..1853052 | - | 1368 | WP_282809999.1 | glutathione-disulfide reductase | - |
| QM552_RS08385 (C4PIVTH_1750) | 1853053..1853355 | - | 303 | WP_282810000.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QM552_RS08390 (C4PIVTH_1751) | 1853345..1853590 | - | 246 | WP_048706619.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QM552_RS08395 (C4PIVTH_1752) | 1853687..1854625 | - | 939 | WP_282810001.1 | helix-turn-helix transcriptional regulator | - |
| QM552_RS08400 (C4PIVTH_1753) | 1854633..1855271 | - | 639 | WP_282810002.1 | molybdenum cofactor guanylyltransferase MobA | - |
| QM552_RS08405 (C4PIVTH_1754) | 1855333..1856160 | - | 828 | WP_282810003.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
| QM552_RS08410 (C4PIVTH_1755) | 1856318..1856785 | + | 468 | WP_282810004.1 | DUF3305 domain-containing protein | - |
| QM552_RS08415 (C4PIVTH_1756) | 1856782..1857426 | + | 645 | WP_282810005.1 | DUF3306 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1846474..1856160 | 9686 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11681.64 Da Isoelectric Point: 10.2579
>T295076 WP_282810000.1 NZ_OW011623:c1853355-1853053 [Thauera sp. PIV-1]
MSYKLRFHSLALAEWRKLDGSLRLQFKKKLEERLITPRVPSSALSGMPDCYKIKLRAVGYRLVYRVDEDVVFVTVISVGL
RDKQRVYSKAHARLDEPEQD
MSYKLRFHSLALAEWRKLDGSLRLQFKKKLEERLITPRVPSSALSGMPDCYKIKLRAVGYRLVYRVDEDVVFVTVISVGL
RDKQRVYSKAHARLDEPEQD
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|