Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2963185..2963681 Replicon chromosome
Accession NZ_OV996158
Organism Enterococcus mundtii strain P2005

Toxin (Protein)


Gene name relE Uniprot ID A0A242KVG2
Locus tag N7O26_RS13545 Protein ID WP_071868044.1
Coordinates 2963415..2963681 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2K8TJA3
Locus tag N7O26_RS13540 Protein ID WP_071868045.1
Coordinates 2963185..2963418 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7O26_RS13505 2958329..2959084 + 756 WP_023518917.1 ATP-binding cassette domain-containing protein -
N7O26_RS13510 2959106..2960059 + 954 WP_019723617.1 siderophore ABC transporter substrate-binding protein -
N7O26_RS13515 2960128..2960250 - 123 WP_254905451.1 hypothetical protein -
N7O26_RS13520 2960318..2960614 - 297 WP_010734416.1 hypothetical protein -
N7O26_RS13525 2960834..2961412 + 579 WP_010734415.1 GNAT family N-acetyltransferase -
N7O26_RS13530 2961460..2961819 + 360 WP_010734414.1 iron-sulfur cluster biosynthesis family protein -
N7O26_RS13535 2961838..2962734 + 897 WP_023518919.1 metallophosphoesterase -
N7O26_RS13540 2963185..2963418 + 234 WP_071868045.1 DUF6290 family protein Antitoxin
N7O26_RS13545 2963415..2963681 + 267 WP_071868044.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7O26_RS13550 2964092..2964826 - 735 WP_019723412.1 MIP/aquaporin family protein -
N7O26_RS13555 2965251..2966789 + 1539 WP_260697861.1 helix-turn-helix domain-containing protein -
N7O26_RS13560 2966779..2967000 + 222 WP_010734410.1 DUF2829 domain-containing protein -
N7O26_RS13565 2966997..2967758 + 762 WP_019723414.1 3-oxoacyl-ACP reductase -
N7O26_RS13570 2967787..2968434 + 648 WP_074800047.1 DUF998 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-63)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10454.18 Da        Isoelectric Point: 10.7105

>T295074 WP_071868044.1 NZ_OV996158:2963415-2963681 [Enterococcus mundtii]
MSYSVRTTPTFDRQIRKLDKFEATTILRWLHKQIEGTKNPRYTGKPLVGNYAGKWRYRIGNYRVITKIDDEKLIVLALEV
GHRKNIYL

Download         Length: 267 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8825.00 Da        Isoelectric Point: 4.2984

>AT295074 WP_071868045.1 NZ_OV996158:2963185-2963418 [Enterococcus mundtii]
MATITVRVTEDEKKFLDEMAKFEGKSLSELLKTKTLDALEDAYDAKIGDLAYEEYLKDKKSNDLSVLLEEYDIGEKK

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A242KVG2

Antitoxin

Source ID Structure
AlphaFold DB A0A2K8TJA3

References