Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1348786..1349440 Replicon chromosome
Accession NZ_OV996158
Organism Enterococcus mundtii strain P2005

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N7O26_RS06280 Protein ID WP_260697541.1
Coordinates 1349297..1349440 (-) Length 48 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N7O26_RS06275 Protein ID WP_086334731.1
Coordinates 1348786..1349220 (-) Length 145 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7O26_RS06250 1345032..1345841 - 810 WP_260697539.1 propanediol utilization microcompartment protein PduB -
N7O26_RS06255 1345852..1346133 - 282 WP_260697540.1 BMC domain-containing protein -
N7O26_RS06260 1346414..1347322 + 909 WP_108173369.1 PocR ligand-binding domain-containing protein -
N7O26_RS06265 1347690..1348124 - 435 WP_074799124.1 EutP/PduV family microcompartment system protein -
N7O26_RS06270 1348168..1348521 - 354 WP_071867470.1 BMC domain-containing protein -
N7O26_RS06275 1348786..1349220 - 435 WP_086334731.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N7O26_RS06280 1349297..1349440 - 144 WP_260697541.1 type II toxin-antitoxin system HicA family toxin Toxin
N7O26_RS06285 1349703..1350110 - 408 WP_260697542.1 NusG domain II-containing protein -
N7O26_RS06290 1350147..1350524 - 378 WP_074799133.1 hypothetical protein -
N7O26_RS06295 1350556..1350723 - 168 WP_260697543.1 50S ribosomal protein L32 -
N7O26_RS06300 1350741..1351010 - 270 WP_074799138.1 30S ribosomal protein S14 -
N7O26_RS06305 1351262..1351621 - 360 WP_260697544.1 YxeA family protein -
N7O26_RS06310 1351865..1353226 - 1362 WP_260697545.1 C39 family peptidase -
N7O26_RS06315 1353453..1354160 - 708 WP_071867695.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-47)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(10-104)


Sequences

Toxin        


Download         Length: 48 a.a.        Molecular weight: 5460.33 Da        Isoelectric Point: 10.4656

>T295073 WP_260697541.1 NZ_OV996158:c1349440-1349297 [Enterococcus mundtii]
MPLTGKEMLRLLKKNGWIERRQEGSHHHLYKDGVRITVPVHANQDLG

Download         Length: 144 bp

Antitoxin


Download         Length: 145 a.a.        Molecular weight: 16053.26 Da        Isoelectric Point: 4.3544

>AT295073 WP_086334731.1 NZ_OV996158:c1349220-1348786 [Enterococcus mundtii]
MLSEPLAKTYPAIFKPEEGGGYFIEFPDIQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEEQIPEPTPIKEVFAEKD
SFTTLIRVDVAKYLKDTELVKKTLTIPRWADTLGKRAGINFSVLLTESIADKADDILHSGKNNR

Download         Length: 435 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References