Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 300518..301186 | Replicon | chromosome |
| Accession | NZ_OV996158 | ||
| Organism | Enterococcus mundtii strain P2005 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N7O26_RS01405 | Protein ID | WP_108145382.1 |
| Coordinates | 300518..300691 (+) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N7O26_RS01410 | Protein ID | WP_108145381.1 |
| Coordinates | 300731..301186 (+) | Length | 152 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7O26_RS01385 | 296635..297714 | + | 1080 | WP_104775574.1 | prephenate dehydrogenase | - |
| N7O26_RS01390 | 297719..299002 | + | 1284 | WP_260697330.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| N7O26_RS01395 | 299002..299508 | + | 507 | WP_019722393.1 | shikimate kinase | - |
| N7O26_RS01400 | 299505..300371 | + | 867 | WP_108145383.1 | prephenate dehydratase | - |
| N7O26_RS01405 | 300518..300691 | + | 174 | WP_108145382.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7O26_RS01410 | 300731..301186 | + | 456 | WP_108145381.1 | hypothetical protein | Antitoxin |
| N7O26_RS01415 | 301311..301820 | + | 510 | WP_010736264.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| N7O26_RS01420 | 301908..303104 | - | 1197 | WP_260697331.1 | galactokinase | - |
| N7O26_RS01425 | 303101..304141 | - | 1041 | WP_108145379.1 | aldose epimerase family protein | - |
| N7O26_RS01430 | 304369..305274 | + | 906 | WP_010736261.1 | AraC family transcriptional regulator | - |
| N7O26_RS01435 | 305343..306020 | + | 678 | WP_010736260.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6110.47 Da Isoelectric Point: 11.5522
>T295072 WP_108145382.1 NZ_OV996158:300518-300691 [Enterococcus mundtii]
MPMTQQEMVKLLISIGGLKVKGGKGSHIKVKLPGVNRPIIVPSKLPKGTEHAILRQG
MPMTQQEMVKLLISIGGLKVKGGKGSHIKVKLPGVNRPIIVPSKLPKGTEHAILRQG
Download Length: 174 bp
Antitoxin
Download Length: 152 a.a. Molecular weight: 16761.90 Da Isoelectric Point: 3.9297
>AT295072 WP_108145381.1 NZ_OV996158:300731-301186 [Enterococcus mundtii]
MLVSYPALFYLETSEGYDSGFSVFFPDFPEMAGTSGSDIPEALENASDYLGILLAAEIEEDRTLPEPSLISSLSLIENNP
FKSDSEFILEYDSEKSFISMVAVDLTEYLGSEEPVKKTLTIPKWADKLGKEMHLNFSKTLTEAIVREKLGA
MLVSYPALFYLETSEGYDSGFSVFFPDFPEMAGTSGSDIPEALENASDYLGILLAAEIEEDRTLPEPSLISSLSLIENNP
FKSDSEFILEYDSEKSFISMVAVDLTEYLGSEEPVKKTLTIPKWADKLGKEMHLNFSKTLTEAIVREKLGA
Download Length: 456 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|