Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4740938..4741454 | Replicon | chromosome |
Accession | NZ_OV754010 | ||
Organism | Klebsiella pneumoniae isolate BB1541 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | O0V11_RS23125 | Protein ID | WP_004178374.1 |
Coordinates | 4740938..4741222 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | O0V11_RS23130 | Protein ID | WP_002886901.1 |
Coordinates | 4741212..4741454 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0V11_RS23100 (VKR_04541) | 4736355..4736618 | - | 264 | WP_025987940.1 | PTS sugar transporter subunit IIB | - |
O0V11_RS23105 | 4736748..4736921 | + | 174 | WP_019725541.1 | hypothetical protein | - |
O0V11_RS23110 (VKR_04542) | 4736924..4737667 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
O0V11_RS23115 (VKR_04543) | 4738024..4740162 | + | 2139 | WP_019725540.1 | anaerobic ribonucleoside-triphosphate reductase | - |
O0V11_RS23120 (VKR_04544) | 4740470..4740934 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
O0V11_RS23125 (VKR_04545) | 4740938..4741222 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O0V11_RS23130 (VKR_04546) | 4741212..4741454 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O0V11_RS23135 (VKR_04547) | 4741532..4743442 | - | 1911 | WP_019725539.1 | PRD domain-containing protein | - |
O0V11_RS23140 (VKR_04548) | 4743465..4744619 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
O0V11_RS23145 (VKR_04549) | 4744686..4745426 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T295064 WP_004178374.1 NZ_OV754010:c4741222-4740938 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |