Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4660849..4661540 | Replicon | chromosome |
Accession | NZ_OV754010 | ||
Organism | Klebsiella pneumoniae isolate BB1541 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A483YFJ1 |
Locus tag | O0V11_RS22790 | Protein ID | WP_025987721.1 |
Coordinates | 4660849..4661190 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A2A5MHA6 |
Locus tag | O0V11_RS22795 | Protein ID | WP_019725272.1 |
Coordinates | 4661214..4661540 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0V11_RS22775 (VKR_04477) | 4657808..4659043 | - | 1236 | WP_124044824.1 | hypothetical protein | - |
O0V11_RS22780 (VKR_04478) | 4659503..4659874 | - | 372 | WP_223369725.1 | hypothetical protein | - |
O0V11_RS22785 (VKR_04479) | 4659901..4660734 | - | 834 | WP_025987720.1 | DUF4942 domain-containing protein | - |
O0V11_RS22790 (VKR_04480) | 4660849..4661190 | - | 342 | WP_025987721.1 | TA system toxin CbtA family protein | Toxin |
O0V11_RS22795 (VKR_04481) | 4661214..4661540 | - | 327 | WP_019725272.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O0V11_RS22800 (VKR_04482) | 4661554..4662030 | - | 477 | WP_019725273.1 | DNA repair protein RadC | - |
O0V11_RS22805 (VKR_04483) | 4662040..4662486 | - | 447 | WP_025987722.1 | antirestriction protein | - |
O0V11_RS22810 (VKR_04484) | 4662698..4663387 | - | 690 | WP_009309812.1 | hypothetical protein | - |
O0V11_RS22815 (VKR_04485) | 4663952..4664842 | - | 891 | WP_019725276.1 | YfjP family GTPase | - |
O0V11_RS22820 (VKR_04486) | 4664925..4666013 | - | 1089 | WP_019725277.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4643767..4682688 | 38921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12867.90 Da Isoelectric Point: 8.5195
>T295063 WP_025987721.1 NZ_OV754010:c4661190-4660849 [Klebsiella pneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483YFJ1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MHA6 |