Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4001647..4002266 Replicon chromosome
Accession NZ_OV754010
Organism Klebsiella pneumoniae isolate BB1541

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag O0V11_RS19615 Protein ID WP_002892050.1
Coordinates 4002048..4002266 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag O0V11_RS19610 Protein ID WP_002892066.1
Coordinates 4001647..4002021 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O0V11_RS19600 (VKR_03849) 3996799..3997992 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
O0V11_RS19605 (VKR_03850) 3998015..4001161 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
O0V11_RS19610 (VKR_03851) 4001647..4002021 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
O0V11_RS19615 (VKR_03852) 4002048..4002266 + 219 WP_002892050.1 HHA domain-containing protein Toxin
O0V11_RS19620 (VKR_03853) 4002429..4002995 + 567 WP_002892030.1 maltose O-acetyltransferase -
O0V11_RS19625 4002967..4003107 - 141 WP_004147370.1 hypothetical protein -
O0V11_RS19630 (VKR_03854) 4003128..4003598 + 471 WP_002892026.1 YlaC family protein -
O0V11_RS19635 (VKR_03855) 4003573..4005024 - 1452 WP_064145206.1 PLP-dependent aminotransferase family protein -
O0V11_RS19640 (VKR_03856) 4005125..4005823 + 699 WP_004177238.1 GNAT family protein -
O0V11_RS19645 (VKR_03857) 4005820..4005960 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
O0V11_RS19650 (VKR_03858) 4005960..4006223 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T295061 WP_002892050.1 NZ_OV754010:4002048-4002266 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT295061 WP_002892066.1 NZ_OV754010:4001647-4002021 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References