Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 831632..832289 | Replicon | chromosome |
Accession | NZ_OV754010 | ||
Organism | Klebsiella pneumoniae isolate BB1541 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | O0V11_RS04160 | Protein ID | WP_002916310.1 |
Coordinates | 831879..832289 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | O0V11_RS04155 | Protein ID | WP_002916312.1 |
Coordinates | 831632..831898 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0V11_RS04130 (VKR_00820) | 826788..828221 | - | 1434 | WP_064145187.1 | 6-phospho-beta-glucosidase | - |
O0V11_RS04135 (VKR_00821) | 828340..829068 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
O0V11_RS04140 (VKR_00822) | 829118..829429 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
O0V11_RS04145 (VKR_00823) | 829593..830252 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
O0V11_RS04150 (VKR_00824) | 830403..831386 | - | 984 | WP_064145188.1 | tRNA-modifying protein YgfZ | - |
O0V11_RS04155 (VKR_00825) | 831632..831898 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
O0V11_RS04160 (VKR_00826) | 831879..832289 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
O0V11_RS04165 (VKR_00827) | 832296..832817 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
O0V11_RS04170 (VKR_00828) | 832918..833814 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
O0V11_RS04175 (VKR_00829) | 833837..834550 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O0V11_RS04180 (VKR_00830) | 834556..836289 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T295055 WP_002916310.1 NZ_OV754010:831879-832289 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |