Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 47940..48676 | Replicon | plasmid BB1542_1 |
| Accession | NZ_OV753988 | ||
| Organism | Klebsiella pneumoniae isolate BB1542 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | O0552_RS25985 | Protein ID | WP_003026803.1 |
| Coordinates | 48194..48676 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | O0552_RS25980 | Protein ID | WP_003026799.1 |
| Coordinates | 47940..48206 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0552_RS25960 | 43676..44131 | - | 456 | Protein_39 | transposase domain-containing protein | - |
| O0552_RS25965 | 44242..45473 | - | 1232 | Protein_40 | IS3 family transposase | - |
| O0552_RS25970 | 47000..47305 | + | 306 | WP_074443076.1 | CPBP family intramembrane metalloprotease | - |
| O0552_RS25975 (VKR_05115) | 47455..47716 | - | 262 | Protein_42 | transposase | - |
| O0552_RS25980 (VKR_05116) | 47940..48206 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| O0552_RS25985 (VKR_05117) | 48194..48676 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| O0552_RS25990 | 48887..50233 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| O0552_RS25995 (VKR_05119) | 50393..51097 | + | 705 | WP_040167821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| O0552_RS26000 (VKR_05120) | 51229..51810 | + | 582 | Protein_47 | heat resistance protein YfdX2 | - |
| O0552_RS26005 (VKR_05121) | 51900..52541 | + | 642 | WP_023329026.1 | heat resistance membrane protein HdeD-GI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB19 / floR / tet(A) | - | 1..205644 | 205644 | |
| - | inside | IScluster/Tn | - | - | 44242..50233 | 5991 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T295052 WP_003026803.1 NZ_OV753988:48194-48676 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |