Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4740828..4741344 | Replicon | chromosome |
| Accession | NZ_OV753987 | ||
| Organism | Klebsiella pneumoniae isolate BB1542 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | O0552_RS23115 | Protein ID | WP_004178374.1 |
| Coordinates | 4740828..4741112 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | O0552_RS23120 | Protein ID | WP_002886901.1 |
| Coordinates | 4741102..4741344 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O0552_RS23090 (VKR_04533) | 4736245..4736508 | - | 264 | WP_025987940.1 | PTS sugar transporter subunit IIB | - |
| O0552_RS23095 | 4736638..4736811 | + | 174 | WP_019725541.1 | hypothetical protein | - |
| O0552_RS23100 (VKR_04534) | 4736814..4737557 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| O0552_RS23105 (VKR_04535) | 4737914..4740052 | + | 2139 | WP_019725540.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| O0552_RS23110 (VKR_04536) | 4740360..4740824 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| O0552_RS23115 (VKR_04537) | 4740828..4741112 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O0552_RS23120 (VKR_04538) | 4741102..4741344 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| O0552_RS23125 (VKR_04539) | 4741422..4743332 | - | 1911 | WP_019725539.1 | PRD domain-containing protein | - |
| O0552_RS23130 (VKR_04540) | 4743355..4744509 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| O0552_RS23135 (VKR_04541) | 4744576..4745316 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T295049 WP_004178374.1 NZ_OV753987:c4741112-4740828 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |