Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4001530..4002149 Replicon chromosome
Accession NZ_OV753987
Organism Klebsiella pneumoniae isolate BB1542

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag O0552_RS19605 Protein ID WP_002892050.1
Coordinates 4001931..4002149 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag O0552_RS19600 Protein ID WP_002892066.1
Coordinates 4001530..4001904 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O0552_RS19590 (VKR_03841) 3996682..3997875 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
O0552_RS19595 (VKR_03842) 3997898..4001044 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
O0552_RS19600 (VKR_03843) 4001530..4001904 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
O0552_RS19605 (VKR_03844) 4001931..4002149 + 219 WP_002892050.1 HHA domain-containing protein Toxin
O0552_RS19610 (VKR_03845) 4002312..4002878 + 567 WP_002892030.1 maltose O-acetyltransferase -
O0552_RS19615 4002850..4002990 - 141 WP_004147370.1 hypothetical protein -
O0552_RS19620 (VKR_03846) 4003011..4003481 + 471 WP_002892026.1 YlaC family protein -
O0552_RS19625 (VKR_03847) 4003456..4004907 - 1452 WP_064145206.1 PLP-dependent aminotransferase family protein -
O0552_RS19630 (VKR_03848) 4005008..4005706 + 699 WP_004177238.1 GNAT family protein -
O0552_RS19635 (VKR_03849) 4005703..4005843 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
O0552_RS19640 (VKR_03850) 4005843..4006106 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T295046 WP_002892050.1 NZ_OV753987:4001931-4002149 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT295046 WP_002892066.1 NZ_OV753987:4001530-4001904 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References