Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4001530..4002149 | Replicon | chromosome |
Accession | NZ_OV753987 | ||
Organism | Klebsiella pneumoniae isolate BB1542 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | O0552_RS19605 | Protein ID | WP_002892050.1 |
Coordinates | 4001931..4002149 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | O0552_RS19600 | Protein ID | WP_002892066.1 |
Coordinates | 4001530..4001904 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O0552_RS19590 (VKR_03841) | 3996682..3997875 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
O0552_RS19595 (VKR_03842) | 3997898..4001044 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
O0552_RS19600 (VKR_03843) | 4001530..4001904 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
O0552_RS19605 (VKR_03844) | 4001931..4002149 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
O0552_RS19610 (VKR_03845) | 4002312..4002878 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
O0552_RS19615 | 4002850..4002990 | - | 141 | WP_004147370.1 | hypothetical protein | - |
O0552_RS19620 (VKR_03846) | 4003011..4003481 | + | 471 | WP_002892026.1 | YlaC family protein | - |
O0552_RS19625 (VKR_03847) | 4003456..4004907 | - | 1452 | WP_064145206.1 | PLP-dependent aminotransferase family protein | - |
O0552_RS19630 (VKR_03848) | 4005008..4005706 | + | 699 | WP_004177238.1 | GNAT family protein | - |
O0552_RS19635 (VKR_03849) | 4005703..4005843 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
O0552_RS19640 (VKR_03850) | 4005843..4006106 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295046 WP_002892050.1 NZ_OV753987:4001931-4002149 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT295046 WP_002892066.1 NZ_OV753987:4001530-4001904 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |