Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 88870..89606 | Replicon | plasmid BB1501_1 |
| Accession | NZ_OV753635 | ||
| Organism | Klebsiella quasipneumoniae isolate BB1501 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | OZE11_RS26585 | Protein ID | WP_004187044.1 |
| Coordinates | 89124..89606 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OZE11_RS26580 | Protein ID | WP_003026799.1 |
| Coordinates | 88870..89136 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZE11_RS26555 (VKR_05279) | 83879..84082 | + | 204 | WP_004150739.1 | HHA domain-containing protein | - |
| OZE11_RS26560 (VKR_05280) | 84190..85158 | + | 969 | WP_013815099.1 | IS5-like element IS903B family transposase | - |
| OZE11_RS26565 (VKR_05281) | 85233..85736 | + | 504 | WP_256656753.1 | cytosine permease | - |
| OZE11_RS26570 (VKR_05282) | 85748..86956 | + | 1209 | WP_057072740.1 | imidazolonepropionase | - |
| OZE11_RS26575 (VKR_05283) | 86949..87758 | + | 810 | WP_023329017.1 | N-formylglutamate deformylase | - |
| OZE11_RS26580 (VKR_05284) | 88870..89136 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OZE11_RS26585 | 89124..89606 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| OZE11_RS26590 (VKR_05285) | 89817..91163 | + | 1347 | WP_151114741.1 | ISNCY family transposase | - |
| OZE11_RS26595 (VKR_05286) | 91320..92027 | + | 708 | WP_087796141.1 | toll/interleukin-1 receptor domain-containing protein | - |
| OZE11_RS26600 (VKR_05287) | 92289..93635 | + | 1347 | WP_267668018.1 | ISNCY family transposase | - |
| OZE11_RS26605 (VKR_05288) | 93684..94079 | + | 396 | WP_021312679.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..207699 | 207699 | |
| - | inside | IScluster/Tn | - | - | 84190..104230 | 20040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T295037 WP_004187044.1 NZ_OV753635:89124-89606 [Klebsiella quasipneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|