Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 19686..20329 Replicon plasmid BB1501_1
Accession NZ_OV753635
Organism Klebsiella quasipneumoniae isolate BB1501

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OZE11_RS26240 Protein ID WP_001044770.1
Coordinates 19913..20329 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OZE11_RS26235 Protein ID WP_001261282.1
Coordinates 19686..19916 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZE11_RS26215 (VKR_05214) 17023..18048 + 1026 WP_064169702.1 hypothetical protein -
OZE11_RS26220 18341..18781 - 441 WP_074193387.1 hypothetical protein -
OZE11_RS26225 (VKR_05215) 18800..19423 - 624 WP_225319983.1 hypothetical protein -
OZE11_RS26230 19502..19729 - 228 Protein_22 hypothetical protein -
OZE11_RS26235 (VKR_05216) 19686..19916 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OZE11_RS26240 (VKR_05217) 19913..20329 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OZE11_RS26245 (VKR_05218) 20403..20525 + 123 Protein_25 hypothetical protein -
OZE11_RS26250 (VKR_05219) 20568..21272 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
OZE11_RS26255 (VKR_05220) 21336..22596 + 1261 Protein_27 Tn3 family transposase -
OZE11_RS26260 (VKR_05221) 22630..23118 - 489 Protein_28 substrate-binding domain-containing protein -
OZE11_RS26265 (VKR_05222) 23681..23881 - 201 WP_022631502.1 hypothetical protein -
OZE11_RS26270 (VKR_05223) 24182..25150 - 969 WP_013815099.1 IS5-like element IS903B family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..207699 207699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T295036 WP_001044770.1 NZ_OV753635:19913-20329 [Klebsiella quasipneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT295036 WP_001261282.1 NZ_OV753635:19686-19916 [Klebsiella quasipneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References