Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 12815..13340 | Replicon | plasmid BB1501_1 |
Accession | NZ_OV753635 | ||
Organism | Klebsiella quasipneumoniae isolate BB1501 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A7H9GHC5 |
Locus tag | OZE11_RS26200 | Protein ID | WP_009309918.1 |
Coordinates | 12815..13120 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A1D8K3R4 |
Locus tag | OZE11_RS26205 | Protein ID | WP_006788213.1 |
Coordinates | 13122..13340 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE11_RS26165 (VKR_05204) | 8104..9081 | - | 978 | Protein_9 | IS5 family transposase | - |
OZE11_RS26170 (VKR_05205) | 9477..9590 | + | 114 | WP_014343462.1 | hypothetical protein | - |
OZE11_RS26175 (VKR_05206) | 9719..9976 | + | 258 | WP_009310077.1 | hypothetical protein | - |
OZE11_RS26180 (VKR_05207) | 10034..10813 | - | 780 | WP_023287113.1 | site-specific integrase | - |
OZE11_RS26185 (VKR_05208) | 11011..12027 | - | 1017 | WP_009309921.1 | hypothetical protein | - |
OZE11_RS26190 (VKR_05209) | 12061..12396 | - | 336 | WP_009309920.1 | hypothetical protein | - |
OZE11_RS26195 | 12446..12586 | - | 141 | WP_162898808.1 | hypothetical protein | - |
OZE11_RS26200 (VKR_05211) | 12815..13120 | - | 306 | WP_009309918.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OZE11_RS26205 (VKR_05212) | 13122..13340 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OZE11_RS26210 (VKR_05213) | 14051..16705 | + | 2655 | WP_064169703.1 | hypothetical protein | - |
OZE11_RS26215 (VKR_05214) | 17023..18048 | + | 1026 | WP_064169702.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..207699 | 207699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11571.24 Da Isoelectric Point: 6.4661
>T295035 WP_009309918.1 NZ_OV753635:c13120-12815 [Klebsiella quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVVPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVVPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H9GHC5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8K3R4 |