Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4789107..4789620 | Replicon | chromosome |
| Accession | NZ_OV753634 | ||
| Organism | Klebsiella quasipneumoniae isolate BB1501 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A663BE04 |
| Locus tag | OZE11_RS23530 | Protein ID | WP_017900571.1 |
| Coordinates | 4789107..4789388 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | OZE11_RS23535 | Protein ID | WP_002886901.1 |
| Coordinates | 4789378..4789620 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZE11_RS23515 (4784215) | 4784215..4785870 | + | 1656 | WP_004206514.1 | alpha,alpha-phosphotrehalase | - |
| OZE11_RS23520 (4786256) | 4786256..4788394 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OZE11_RS23525 (4788639) | 4788639..4789103 | + | 465 | WP_094309610.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OZE11_RS23530 (4789107) | 4789107..4789388 | - | 282 | WP_017900571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OZE11_RS23535 (4789378) | 4789378..4789620 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZE11_RS23540 (4789698) | 4789698..4791608 | - | 1911 | WP_094309609.1 | PRD domain-containing protein | - |
| OZE11_RS23545 (4791631) | 4791631..4792782 | - | 1152 | WP_094309608.1 | lactonase family protein | - |
| OZE11_RS23550 (4792849) | 4792849..4793589 | - | 741 | WP_049003745.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11082.93 Da Isoelectric Point: 10.4123
>T295034 WP_017900571.1 NZ_OV753634:c4789388-4789107 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663BE04 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |