Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4719365..4719990 | Replicon | chromosome |
Accession | NZ_OV753634 | ||
Organism | Klebsiella quasipneumoniae isolate BB1501 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A483YFJ1 |
Locus tag | OZE11_RS23225 | Protein ID | WP_025987721.1 |
Coordinates | 4719365..4719706 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | OZE11_RS23230 | Protein ID | WP_267668002.1 |
Coordinates | 4719730..4719990 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE11_RS23210 (4716359) | 4716359..4717594 | - | 1236 | WP_139110622.1 | hypothetical protein | - |
OZE11_RS23215 (4718019) | 4718019..4718390 | - | 372 | WP_227506902.1 | hypothetical protein | - |
OZE11_RS23220 (4718417) | 4718417..4719250 | - | 834 | WP_040173641.1 | DUF4942 domain-containing protein | - |
OZE11_RS23225 (4719365) | 4719365..4719706 | - | 342 | WP_025987721.1 | TA system toxin CbtA family protein | Toxin |
OZE11_RS23230 (4719730) | 4719730..4719990 | - | 261 | WP_267668002.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OZE11_RS23235 (4720066) | 4720066..4721604 | - | 1539 | WP_004181747.1 | IS66 family transposase | - |
OZE11_RS23240 (4721654) | 4721654..4722001 | - | 348 | WP_004114612.1 | IS66 family insertion sequence element accessory protein TnpB | - |
OZE11_RS23245 (4721998) | 4721998..4722375 | - | 378 | WP_004118218.1 | transposase | - |
OZE11_RS23250 (4722517) | 4722517..4722993 | - | 477 | WP_019725273.1 | DNA repair protein RadC | - |
OZE11_RS23255 (4723003) | 4723003..4723449 | - | 447 | WP_025987722.1 | antirestriction protein | - |
OZE11_RS23260 (4723660) | 4723660..4724349 | - | 690 | WP_009309812.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4705149..4741150 | 36001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12867.90 Da Isoelectric Point: 8.5195
>T295033 WP_025987721.1 NZ_OV753634:c4719706-4719365 [Klebsiella quasipneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|