Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4072783..4073402 Replicon chromosome
Accession NZ_OV753634
Organism Klebsiella quasipneumoniae isolate BB1501

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OZE11_RS20135 Protein ID WP_002892050.1
Coordinates 4073184..4073402 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OZE11_RS20130 Protein ID WP_002892066.1
Coordinates 4072783..4073157 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZE11_RS20120 (4067936) 4067936..4069129 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OZE11_RS20125 (4069152) 4069152..4072298 + 3147 WP_017898892.1 multidrug efflux RND transporter permease subunit AcrB -
OZE11_RS20130 (4072783) 4072783..4073157 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OZE11_RS20135 (4073184) 4073184..4073402 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OZE11_RS20140 (4073561) 4073561..4074127 + 567 WP_004204750.1 maltose O-acetyltransferase -
OZE11_RS20145 (4074099) 4074099..4074221 - 123 WP_032426076.1 hypothetical protein -
OZE11_RS20150 (4074264) 4074264..4074734 + 471 WP_004204751.1 YlaC family protein -
OZE11_RS20155 (4074703) 4074703..4076160 - 1458 WP_096833639.1 PLP-dependent aminotransferase family protein -
OZE11_RS20160 (4076261) 4076261..4076959 + 699 WP_004204753.1 GNAT family protein -
OZE11_RS20165 (4076956) 4076956..4077096 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OZE11_RS20170 (4077096) 4077096..4077359 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T295032 WP_002892050.1 NZ_OV753634:4073184-4073402 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT295032 WP_002892066.1 NZ_OV753634:4072783-4073157 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References