Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 801224..801881 | Replicon | chromosome |
Accession | NZ_OV753634 | ||
Organism | Klebsiella quasipneumoniae isolate BB1501 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
Locus tag | OZE11_RS03945 | Protein ID | WP_004205323.1 |
Coordinates | 801471..801881 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OZE11_RS03940 | Protein ID | WP_002916312.1 |
Coordinates | 801224..801490 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE11_RS03915 (796433) | 796433..797866 | - | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
OZE11_RS03920 (797985) | 797985..798713 | - | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
OZE11_RS03925 (798763) | 798763..799074 | + | 312 | WP_004205318.1 | N(4)-acetylcytidine aminohydrolase | - |
OZE11_RS03930 (799237) | 799237..799896 | + | 660 | WP_004205319.1 | hemolysin III family protein | - |
OZE11_RS03935 (799995) | 799995..800978 | - | 984 | WP_017899798.1 | tRNA-modifying protein YgfZ | - |
OZE11_RS03940 (801224) | 801224..801490 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OZE11_RS03945 (801471) | 801471..801881 | + | 411 | WP_004205323.1 | protein YgfX | Toxin |
OZE11_RS03950 (801888) | 801888..802409 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
OZE11_RS03955 (802510) | 802510..803406 | + | 897 | WP_080936033.1 | site-specific tyrosine recombinase XerD | - |
OZE11_RS03960 (803429) | 803429..804142 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OZE11_RS03965 (804148) | 804148..805881 | + | 1734 | WP_004205327.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T295026 WP_004205323.1 NZ_OV753634:801471-801881 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MNX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |