Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2021677..2022206 | Replicon | chromosome |
| Accession | NZ_OV648025 | ||
| Organism | Staphylococcus argenteus isolate 20S00001-1_long | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7U7JQG1 |
| Locus tag | MD993_RS09590 | Protein ID | WP_000621178.1 |
| Coordinates | 2021677..2022039 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | MD993_RS09595 | Protein ID | WP_000948331.1 |
| Coordinates | 2022036..2022206 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MD993_RS09570 | 2018659..2019429 | - | 771 | WP_001041104.1 | RNA polymerase sigma factor SigB | - |
| MD993_RS09575 | 2019404..2019883 | - | 480 | WP_001190826.1 | anti-sigma B factor RsbW | - |
| MD993_RS09580 | 2019885..2020211 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| MD993_RS09585 | 2020328..2021329 | - | 1002 | WP_000390825.1 | PP2C family protein-serine/threonine phosphatase | - |
| MD993_RS09590 | 2021677..2022039 | - | 363 | WP_000621178.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MD993_RS09595 | 2022036..2022206 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| MD993_RS09600 | 2022291..2023439 | - | 1149 | WP_001281137.1 | alanine racemase | - |
| MD993_RS09605 | 2023509..2023868 | - | 360 | WP_031787685.1 | holo-ACP synthase | - |
| MD993_RS09610 | 2023872..2024375 | - | 504 | WP_031787686.1 | PH domain-containing protein | - |
| MD993_RS09615 | 2024362..2025945 | - | 1584 | WP_031787687.1 | PH domain-containing protein | - |
| MD993_RS09620 | 2025938..2026417 | - | 480 | WP_031787688.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13502.79 Da Isoelectric Point: 10.2892
>T295022 WP_000621178.1 NZ_OV648025:c2022039-2021677 [Staphylococcus argenteus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDNKMKEVDNALMISLGLNTMAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDNKMKEVDNALMISLGLNTMAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7JQG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0VRZ1 |