Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1858944..1859731 | Replicon | chromosome |
Accession | NZ_OV648025 | ||
Organism | Staphylococcus argenteus isolate 20S00001-1_long |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | A0A7U7PZK3 |
Locus tag | MD993_RS08660 | Protein ID | WP_000031103.1 |
Coordinates | 1858944..1859099 (-) | Length | 52 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A7U7JVF2 |
Locus tag | MD993_RS08665 | Protein ID | WP_047430475.1 |
Coordinates | 1859132..1859731 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MD993_RS08640 | 1854132..1855244 | - | 1113 | WP_031787927.1 | GAF domain-containing sensor histidine kinase | - |
MD993_RS08645 | 1855406..1856227 | + | 822 | WP_000669386.1 | RluA family pseudouridine synthase | - |
MD993_RS08650 | 1856521..1857906 | - | 1386 | WP_031787928.1 | class II fumarate hydratase | - |
MD993_RS08655 | 1858077..1858478 | - | 402 | WP_000901017.1 | hypothetical protein | - |
MD993_RS08660 | 1858944..1859099 | - | 156 | WP_000031103.1 | SAS053 family protein | Toxin |
MD993_RS08665 | 1859132..1859731 | - | 600 | WP_047430475.1 | glucosamine-6-phosphate isomerase | Antitoxin |
MD993_RS08670 | 1859890..1860360 | - | 471 | WP_000181399.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
MD993_RS08675 | 1860362..1861492 | - | 1131 | WP_031787930.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
MD993_RS08680 | 1861643..1862365 | - | 723 | WP_031787931.1 | amino acid ABC transporter ATP-binding protein | - |
MD993_RS08685 | 1862358..1863815 | - | 1458 | WP_000649887.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 6019.42 Da Isoelectric Point: 4.1469
>T295021 WP_000031103.1 NZ_OV648025:c1859099-1858944 [Staphylococcus argenteus]
MSKDKDAKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKSTDEKNSH
MSKDKDAKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKSTDEKNSH
Download Length: 156 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22438.57 Da Isoelectric Point: 5.3935
>AT295021 WP_047430475.1 NZ_OV648025:c1859731-1859132 [Staphylococcus argenteus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDNKKSYFEALGV
PASQIYPIAFEKDAIEFISDKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKKEVVEKLYQENGK
TSFEPSDLKSHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDNKKSYFEALGV
PASQIYPIAFEKDAIEFISDKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKKEVVEKLYQENGK
TSFEPSDLKSHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7PZK3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7JVF2 |