Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 833384..833861 Replicon chromosome
Accession NZ_OV648025
Organism Staphylococcus argenteus isolate 20S00001-1_long

Toxin (Protein)


Gene name TsaT Uniprot ID A0A7U7JTG2
Locus tag MD993_RS03880 Protein ID WP_000172413.1
Coordinates 833384..833572 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A7U7JTE3
Locus tag MD993_RS03885 Protein ID WP_000790107.1
Coordinates 833601..833861 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MD993_RS03850 829080..829562 + 483 WP_031788350.1 hypothetical protein -
MD993_RS03855 829905..830573 + 669 WP_031788100.1 thermonuclease family protein -
MD993_RS03860 830937..831137 + 201 WP_001059082.1 cold-shock protein -
MD993_RS03865 831750..831962 - 213 WP_001007088.1 hypothetical protein -
MD993_RS03870 832023..832307 - 285 WP_031788101.1 hypothetical protein -
MD993_RS03875 832396..832965 - 570 WP_031788102.1 lipoprotein N-acylation protein LnsA -
MD993_RS03880 833384..833572 - 189 WP_000172413.1 hypothetical protein Toxin
MD993_RS03885 833601..833861 - 261 WP_000790107.1 hypothetical protein Antitoxin
MD993_RS03890 834201..834404 + 204 WP_000145167.1 sterile alpha motif-like domain-containing protein -
MD993_RS03895 834401..834637 - 237 WP_000368686.1 hypothetical protein -
MD993_RS03900 834862..835443 + 582 WP_031788103.1 histidine phosphatase family protein -
MD993_RS03905 835510..836127 - 618 WP_031788104.1 LysE family transporter -
MD993_RS03910 836291..836782 - 492 WP_000695603.1 GNAT family N-acetyltransferase -
MD993_RS03915 837189..837611 - 423 WP_001007646.1 organic hydroperoxide resistance protein -
MD993_RS03920 837760..838479 + 720 WP_047451209.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7192.89 Da        Isoelectric Point: 9.9971

>T295020 WP_000172413.1 NZ_OV648025:c833572-833384 [Staphylococcus argenteus]
MTLHFAILFWLALIFIVAGTFIFVLMKKTAKESKKESYLSFAVIFYIFGFAMLIYTLIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 10089.30 Da        Isoelectric Point: 4.1927

>AT295020 WP_000790107.1 NZ_OV648025:c833861-833601 [Staphylococcus argenteus]
MKNIQLNAINLVITIIFAIFNIMITYNKDLDDLCWLLPGIIICGSILIVSFTIAMITKFWLSEILFFINIVLVLYYIYPI
FYDFIN

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U7JTG2

Antitoxin

Source ID Structure
AlphaFold DB A0A7U7JTE3

References