Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 21874..22517 Replicon plasmid p3
Accession NZ_OV408205
Organism Klebsiella pneumoniae isolate CNR146C9

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NBX86_RS27640 Protein ID WP_001044770.1
Coordinates 22101..22517 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NBX86_RS27635 Protein ID WP_001261282.1
Coordinates 21874..22104 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBX86_RS27595 17072..17545 + 474 WP_004152341.1 YkgJ family cysteine cluster protein -
NBX86_RS27600 17637..17867 + 231 WP_011977773.1 hypothetical protein -
NBX86_RS27605 (AFEHPNKK_05346) 18759..19541 - 783 WP_004152340.1 site-specific integrase -
NBX86_RS27610 (AFEHPNKK_05347) 19541..19873 - 333 WP_004152339.1 hypothetical protein -
NBX86_RS27615 (AFEHPNKK_05348) 19880..20278 - 399 WP_004171440.1 hypothetical protein -
NBX86_RS27620 (AFEHPNKK_05349) 20304..20633 - 330 WP_004152337.1 hypothetical protein -
NBX86_RS27625 (AFEHPNKK_05350) 20661..20969 - 309 WP_004152336.1 hypothetical protein -
NBX86_RS27630 21456..21917 - 462 WP_072093212.1 hypothetical protein -
NBX86_RS27635 (AFEHPNKK_05351) 21874..22104 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NBX86_RS27640 (AFEHPNKK_05352) 22101..22517 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NBX86_RS27645 (AFEHPNKK_05353) 22591..23280 + 690 Protein_24 AAA family ATPase -
NBX86_RS27650 23335..24032 + 698 WP_223174630.1 IS1 family transposase -
NBX86_RS27655 24048..24158 + 111 Protein_26 mercuric transport protein periplasmic component -
NBX86_RS27660 (AFEHPNKK_05356) 24194..24616 + 423 WP_001340589.1 organomercurial transporter MerC -
NBX86_RS27665 (AFEHPNKK_05357) 24668..26362 + 1695 WP_000105636.1 mercury(II) reductase -
NBX86_RS27670 (AFEHPNKK_05358) 26380..26742 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
NBX86_RS27675 (AFEHPNKK_05359) 26739..26975 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1A / blaOXA-9 / blaKPC-3 - 1..110489 110489
- flank IS/Tn - - 15684..16952 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T295019 WP_001044770.1 NZ_OV408205:22101-22517 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT295019 WP_001261282.1 NZ_OV408205:21874-22104 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References