Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 100945..101681 Replicon plasmid p1
Accession NZ_OV408203
Organism Klebsiella pneumoniae isolate CNR146C9

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NBX86_RS26520 Protein ID WP_003026803.1
Coordinates 100945..101427 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NBX86_RS26525 Protein ID WP_003026799.1
Coordinates 101415..101681 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBX86_RS26495 (AFEHPNKK_05133) 96020..96508 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
NBX86_RS26500 (AFEHPNKK_05134) 96495..97457 + 963 WP_004152113.1 zinc metalloprotease HtpX -
NBX86_RS26505 97634..98799 + 1166 Protein_97 IS3 family transposase -
NBX86_RS26510 (AFEHPNKK_05137) 98947..99342 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NBX86_RS26515 (AFEHPNKK_05138) 99391..100737 - 1347 WP_077253535.1 ISNCY family transposase -
NBX86_RS26520 (AFEHPNKK_05139) 100945..101427 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NBX86_RS26525 (AFEHPNKK_05140) 101415..101681 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NBX86_RS26530 (AFEHPNKK_05141) 101857..102111 - 255 WP_004152108.1 hypothetical protein -
NBX86_RS26535 (AFEHPNKK_05142) 102187..102444 - 258 WP_004152107.1 hypothetical protein -
NBX86_RS26540 (AFEHPNKK_05143) 102493..102696 - 204 WP_004152106.1 HHA domain-containing protein -
NBX86_RS26545 (AFEHPNKK_05144) 102730..103098 - 369 WP_004152105.1 hypothetical protein -
NBX86_RS26550 (AFEHPNKK_05145) 103142..103636 - 495 WP_004152104.1 DNA-binding protein -
NBX86_RS26555 (AFEHPNKK_05146) 103667..104242 - 576 WP_004152103.1 hypothetical protein -
NBX86_RS26560 (AFEHPNKK_05147) 104230..104499 - 270 WP_004152102.1 hypothetical protein -
NBX86_RS26565 (AFEHPNKK_05148) 104857..105207 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NBX86_RS26570 (AFEHPNKK_05149) 105257..105619 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IIa / aac(6')-Ib-cr / blaOXA-1 - 1..237007 237007


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T295018 WP_003026803.1 NZ_OV408203:c101427-100945 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT295018 WP_003026799.1 NZ_OV408203:c101681-101415 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References