Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 100945..101681 | Replicon | plasmid p1 |
| Accession | NZ_OV408203 | ||
| Organism | Klebsiella pneumoniae isolate CNR146C9 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | NBX86_RS26520 | Protein ID | WP_003026803.1 |
| Coordinates | 100945..101427 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NBX86_RS26525 | Protein ID | WP_003026799.1 |
| Coordinates | 101415..101681 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBX86_RS26495 (AFEHPNKK_05133) | 96020..96508 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| NBX86_RS26500 (AFEHPNKK_05134) | 96495..97457 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| NBX86_RS26505 | 97634..98799 | + | 1166 | Protein_97 | IS3 family transposase | - |
| NBX86_RS26510 (AFEHPNKK_05137) | 98947..99342 | - | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| NBX86_RS26515 (AFEHPNKK_05138) | 99391..100737 | - | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| NBX86_RS26520 (AFEHPNKK_05139) | 100945..101427 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| NBX86_RS26525 (AFEHPNKK_05140) | 101415..101681 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NBX86_RS26530 (AFEHPNKK_05141) | 101857..102111 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| NBX86_RS26535 (AFEHPNKK_05142) | 102187..102444 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| NBX86_RS26540 (AFEHPNKK_05143) | 102493..102696 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| NBX86_RS26545 (AFEHPNKK_05144) | 102730..103098 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| NBX86_RS26550 (AFEHPNKK_05145) | 103142..103636 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| NBX86_RS26555 (AFEHPNKK_05146) | 103667..104242 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| NBX86_RS26560 (AFEHPNKK_05147) | 104230..104499 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| NBX86_RS26565 (AFEHPNKK_05148) | 104857..105207 | + | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NBX86_RS26570 (AFEHPNKK_05149) | 105257..105619 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB1 / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IIa / aac(6')-Ib-cr / blaOXA-1 | - | 1..237007 | 237007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T295018 WP_003026803.1 NZ_OV408203:c101427-100945 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |