Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4821614..4822130 | Replicon | chromosome |
| Accession | NZ_OV408202 | ||
| Organism | Klebsiella pneumoniae isolate CNR146C9 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | NBX86_RS23360 | Protein ID | WP_004178374.1 |
| Coordinates | 4821614..4821898 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | NBX86_RS23365 | Protein ID | WP_032434351.1 |
| Coordinates | 4821888..4822130 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBX86_RS23335 (4817097) | 4817097..4817405 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| NBX86_RS23340 (4817490) | 4817490..4817663 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| NBX86_RS23345 (4817666) | 4817666..4818409 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NBX86_RS23350 (4818766) | 4818766..4820904 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBX86_RS23355 (4821146) | 4821146..4821610 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBX86_RS23360 (4821614) | 4821614..4821898 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBX86_RS23365 (4821888) | 4821888..4822130 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBX86_RS23370 (4822208) | 4822208..4824118 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NBX86_RS23375 (4824141) | 4824141..4825295 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NBX86_RS23380 (4825361) | 4825361..4826101 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T295015 WP_004178374.1 NZ_OV408202:c4821898-4821614 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|