Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4728886..4729589 | Replicon | chromosome |
| Accession | NZ_OV408202 | ||
| Organism | Klebsiella pneumoniae isolate CNR146C9 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | NBX86_RS22970 | Protein ID | WP_071994632.1 |
| Coordinates | 4728886..4729227 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | NBX86_RS22975 | Protein ID | WP_032434296.1 |
| Coordinates | 4729248..4729589 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBX86_RS22960 (4725201) | 4725201..4726070 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| NBX86_RS22965 (4726661) | 4726661..4728694 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| NBX86_RS22970 (4728886) | 4728886..4729227 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| NBX86_RS22975 (4729248) | 4729248..4729589 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBX86_RS22980 (4729600) | 4729600..4730142 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| NBX86_RS22985 (4730155) | 4730155..4730595 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| NBX86_RS22990 (4730626) | 4730626..4731447 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| NBX86_RS22995 (4731567) | 4731567..4732040 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| NBX86_RS23000 (4732112) | 4732112..4732564 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| NBX86_RS23005 (4732600) | 4732600..4733316 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| NBX86_RS23010 (4733560) | 4733560..4734434 | - | 875 | Protein_4516 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4717183..4762856 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T295014 WP_071994632.1 NZ_OV408202:c4729227-4728886 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|