Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4056512..4057131 Replicon chromosome
Accession NZ_OV408202
Organism Klebsiella pneumoniae isolate CNR146C9

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBX86_RS19755 Protein ID WP_002892050.1
Coordinates 4056913..4057131 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBX86_RS19750 Protein ID WP_002892066.1
Coordinates 4056512..4056886 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBX86_RS19740 (4051664) 4051664..4052857 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NBX86_RS19745 (4052880) 4052880..4056026 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBX86_RS19750 (4056512) 4056512..4056886 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBX86_RS19755 (4056913) 4056913..4057131 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NBX86_RS19760 (4057290) 4057290..4057856 + 567 WP_002892030.1 maltose O-acetyltransferase -
NBX86_RS19765 (4057828) 4057828..4057968 - 141 WP_004147370.1 hypothetical protein -
NBX86_RS19770 (4057989) 4057989..4058459 + 471 WP_002892026.1 YlaC family protein -
NBX86_RS19775 (4058434) 4058434..4059885 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
NBX86_RS19780 (4059986) 4059986..4060684 + 699 WP_032435564.1 GNAT family protein -
NBX86_RS19785 (4060681) 4060681..4060821 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBX86_RS19790 (4060821) 4060821..4061084 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T295012 WP_002892050.1 NZ_OV408202:4056913-4057131 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT295012 WP_002892066.1 NZ_OV408202:4056512-4056886 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References