Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 795599..796256 | Replicon | chromosome |
Accession | NZ_OV408202 | ||
Organism | Klebsiella pneumoniae isolate CNR146C9 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NBX86_RS03945 | Protein ID | WP_002916310.1 |
Coordinates | 795846..796256 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NBX86_RS03940 | Protein ID | WP_002916312.1 |
Coordinates | 795599..795865 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBX86_RS03915 (790807) | 790807..792240 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
NBX86_RS03920 (792359) | 792359..793087 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NBX86_RS03925 (793137) | 793137..793448 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NBX86_RS03930 (793612) | 793612..794271 | + | 660 | WP_004174454.1 | hemolysin III family protein | - |
NBX86_RS03935 (794370) | 794370..795353 | - | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
NBX86_RS03940 (795599) | 795599..795865 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NBX86_RS03945 (795846) | 795846..796256 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
NBX86_RS03950 (796263) | 796263..796784 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
NBX86_RS03955 (796885) | 796885..797781 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NBX86_RS03960 (797804) | 797804..798517 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBX86_RS03965 (798523) | 798523..800256 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T295005 WP_002916310.1 NZ_OV408202:795846-796256 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |