Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 364435..364982 Replicon chromosome
Accession NZ_OV350343
Organism Halomonas sp. TD01 strain Halomonas Bluephagenesis

Toxin (Protein)


Gene name parE Uniprot ID F7SKI1
Locus tag L1X57_RS01745 Protein ID WP_009722255.1
Coordinates 364683..364982 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID F7SKI2
Locus tag L1X57_RS01740 Protein ID WP_009722256.1
Coordinates 364435..364683 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L1X57_RS01715 (HPTD01_348) 359948..360739 - 792 WP_009722262.1 PhzF family phenazine biosynthesis protein -
L1X57_RS01720 (HPTD01_349) 360828..362018 - 1191 WP_009722261.1 multidrug effflux MFS transporter -
L1X57_RS01725 (HPTD01_351) 362242..362538 + 297 WP_009722259.1 DUF1330 domain-containing protein -
L1X57_RS01730 (HPTD01_352) 362800..363000 - 201 WP_009722258.1 DUF808 family protein -
L1X57_RS01735 (HPTD01_353) 363147..364280 - 1134 WP_009722257.1 Fic family protein -
L1X57_RS01740 (HPTD01_354) 364435..364683 + 249 WP_009722256.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
L1X57_RS01745 (HPTD01_355) 364683..364982 + 300 WP_009722255.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
L1X57_RS01750 (HPTD01_356) 365169..366029 - 861 Protein_342 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
L1X57_RS01755 (HPTD01_357) 366078..366890 - 813 WP_050801084.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
L1X57_RS01760 (HPTD01_358) 367053..367247 - 195 WP_009722252.1 DUF4357 domain-containing protein -
L1X57_RS01765 367208..367597 - 390 Protein_345 DUF808 family protein -
L1X57_RS01770 (HPTD01_360) 367870..368118 + 249 WP_009722250.1 type II toxin-antitoxin system ParD family antitoxin -
L1X57_RS01775 (HPTD01_361) 368118..368417 + 300 WP_009722249.1 type II toxin-antitoxin system RelE/ParE family toxin -
L1X57_RS01780 (HPTD01_362) 368418..369116 - 699 WP_009722248.1 LysR family transcriptional regulator substrate-binding protein -
L1X57_RS01785 (HPTD01_363) 369106..369321 - 216 WP_009722247.1 LysR family transcriptional regulator -
L1X57_RS01790 (HPTD01_365) 369427..369891 + 465 WP_260648578.1 EamA family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-91)

Antitoxin

Antitoxin ParD

(1-78)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11946.57 Da        Isoelectric Point: 8.0678

>T294999 WP_009722255.1 NZ_OV350343:364683-364982 [Halomonas sp. TD01]
MLSFRITPRARDDLKNIGRYTEWQWGKNQRNTYLKNFEKRFHWLAENPHLGKHRSDVSEGYYSYPQGQHVIFYLIGQECI
EIIGIPHKEMDIVSYFLPE

Download         Length: 300 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9058.01 Da        Isoelectric Point: 4.3875

>AT294999 WP_009722256.1 NZ_OV350343:364435-364683 [Halomonas sp. TD01]
MATTSLSLGEHWEVFIRNEVASGRYGSASEVVRDALRAMEERKSKLEALRAHLAQGAEQARAGEFVDDFSMDALINDLDS
ET

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB F7SKI1

Antitoxin

Source ID Structure
AlphaFold DB F7SKI2

References