Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-stbD/ParE-DnaT |
Location | 1512162..1512696 | Replicon | chromosome |
Accession | NZ_OV100759 | ||
Organism | Aggregatibacter sp. Marseille-P9115 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LQ983_RS07255 | Protein ID | WP_111278766.1 |
Coordinates | 1512162..1512452 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | LQ983_RS07260 | Protein ID | WP_230622192.1 |
Coordinates | 1512442..1512696 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ983_RS07220 | 1508322..1508633 | - | 312 | WP_230622186.1 | hypothetical protein | - |
LQ983_RS07225 | 1508630..1508803 | - | 174 | WP_230622187.1 | hypothetical protein | - |
LQ983_RS07230 | 1508817..1509826 | - | 1010 | Protein_1385 | site-specific integrase | - |
LQ983_RS07235 | 1509826..1510164 | - | 339 | WP_230622188.1 | hypothetical protein | - |
LQ983_RS07240 | 1510161..1510388 | - | 228 | WP_230622189.1 | host cell division inhibitor Icd-like protein | - |
LQ983_RS07245 | 1510876..1511100 | - | 225 | WP_230622190.1 | helix-turn-helix domain-containing protein | - |
LQ983_RS07250 | 1511213..1512127 | - | 915 | WP_230622191.1 | hypothetical protein | - |
LQ983_RS07255 | 1512162..1512452 | - | 291 | WP_111278766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ983_RS07260 | 1512442..1512696 | - | 255 | WP_230622192.1 | stability protein StbD | Antitoxin |
LQ983_RS07265 | 1512813..1513040 | - | 228 | WP_230622193.1 | hypothetical protein | - |
LQ983_RS07270 | 1513040..1513981 | - | 942 | WP_230622194.1 | P2 family phage major capsid protein | - |
LQ983_RS07275 | 1513993..1514688 | - | 696 | WP_230622195.1 | hypothetical protein | - |
LQ983_RS07280 | 1514685..1514912 | - | 228 | WP_230622196.1 | AlpA family transcriptional regulator | - |
LQ983_RS07285 | 1515565..1516572 | - | 1008 | WP_230622630.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1505212..1516578 | 11366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11515.30 Da Isoelectric Point: 10.4142
>T294996 WP_111278766.1 NZ_OV100759:c1512452-1512162 [Aggregatibacter sp. Marseille-P9115]
MTYKLTFDKRALKEWEKLGDTIRQQFKNKLAERLENPRVIGDKLRGYQNLYKIKLRSAGYRLVYEVNDNQIYILVLSVGK
RDRLDAYKNAEFRQAQ
MTYKLTFDKRALKEWEKLGDTIRQQFKNKLAERLENPRVIGDKLRGYQNLYKIKLRSAGYRLVYEVNDNQIYILVLSVGK
RDRLDAYKNAEFRQAQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|