Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 172458..173083 | Replicon | chromosome |
| Accession | NZ_OV100759 | ||
| Organism | Aggregatibacter sp. Marseille-P9115 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | LQ983_RS00765 | Protein ID | WP_111277555.1 |
| Coordinates | 172901..173083 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ983_RS00760 | Protein ID | WP_230621289.1 |
| Coordinates | 172458..172871 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ983_RS00745 | 169334..169831 | + | 498 | WP_111305910.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| LQ983_RS00750 | 169971..171059 | + | 1089 | WP_230621288.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| LQ983_RS00755 | 171149..172339 | + | 1191 | WP_109842775.1 | amino acid aminotransferase | - |
| LQ983_RS00760 | 172458..172871 | - | 414 | WP_230621289.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LQ983_RS00765 | 172901..173083 | - | 183 | WP_111277555.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LQ983_RS00770 | 173472..174458 | + | 987 | WP_230621290.1 | iron ABC transporter permease | - |
| LQ983_RS00775 | 174468..175256 | + | 789 | WP_230621291.1 | ABC transporter ATP-binding protein | - |
| LQ983_RS00780 | 175269..176303 | + | 1035 | WP_230621292.1 | ABC transporter substrate-binding protein | - |
| LQ983_RS00785 | 176392..176601 | + | 210 | WP_006718235.1 | TOBE domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6883.09 Da Isoelectric Point: 10.8207
>T294995 WP_111277555.1 NZ_OV100759:c173083-172901 [Aggregatibacter sp. Marseille-P9115]
VDSRKIIKMIEADGWIFHHATGSHYHFTHPIKKGIVTVPHPKKDLKKGTENSILKQARLK
VDSRKIIKMIEADGWIFHHATGSHYHFTHPIKKGIVTVPHPKKDLKKGTENSILKQARLK
Download Length: 183 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15114.24 Da Isoelectric Point: 4.6216
>AT294995 WP_230621289.1 NZ_OV100759:c172871-172458 [Aggregatibacter sp. Marseille-P9115]
MLYPIAIEPGDETHAFGVIVPDIPGCFSAGDTLEEAYTNAKAAIAGHLELLVEMGEEVPLPTSMENHRNNPDFTNYGMFF
GVVDVDITHLLGKSEKINITMPAYLIKRIDDFVSTHREYKNRSSFLAKIAADKILSA
MLYPIAIEPGDETHAFGVIVPDIPGCFSAGDTLEEAYTNAKAAIAGHLELLVEMGEEVPLPTSMENHRNNPDFTNYGMFF
GVVDVDITHLLGKSEKINITMPAYLIKRIDDFVSTHREYKNRSSFLAKIAADKILSA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|