Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 115983..116528 | Replicon | chromosome |
Accession | NZ_OV100759 | ||
Organism | Aggregatibacter sp. Marseille-P9115 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LQ983_RS00535 | Protein ID | WP_111305671.1 |
Coordinates | 116256..116528 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LQ983_RS00530 | Protein ID | WP_111305672.1 |
Coordinates | 115983..116255 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ983_RS00515 | 111192..112562 | - | 1371 | WP_230621253.1 | TolC family protein | - |
LQ983_RS00520 | 112649..114580 | - | 1932 | WP_230621254.1 | MacB family efflux pump subunit | - |
LQ983_RS00525 | 114600..115775 | - | 1176 | WP_230621255.1 | efflux RND transporter periplasmic adaptor subunit | - |
LQ983_RS00530 | 115983..116255 | + | 273 | WP_111305672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LQ983_RS00535 | 116256..116528 | + | 273 | WP_111305671.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
LQ983_RS00540 | 116622..118292 | + | 1671 | WP_230621256.1 | glutamine--tRNA ligase | - |
LQ983_RS00545 | 118928..119263 | + | 336 | WP_065286357.1 | Imm8 family immunity protein | - |
LQ983_RS00550 | 119724..119945 | + | 222 | WP_230621257.1 | hypothetical protein | - |
LQ983_RS00555 | 120602..121045 | - | 444 | WP_230621258.1 | peptidoglycan-binding protein LysM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10586.26 Da Isoelectric Point: 9.5300
>T294994 WP_111305671.1 NZ_OV100759:116256-116528 [Aggregatibacter sp. Marseille-P9115]
MKISFTKDYKRDLKRLANQPEILLSAEMIDVMHHLLNGKNLPEKYKDHALSGNWKGFRDCHIKNDLVLIYHVNNEGLTLV
RLNTHSEVFR
MKISFTKDYKRDLKRLANQPEILLSAEMIDVMHHLLNGKNLPEKYKDHALSGNWKGFRDCHIKNDLVLIYHVNNEGLTLV
RLNTHSEVFR
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|