Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 45010..45533 Replicon plasmid DJ_6_pKPX1
Accession NZ_OV049814
Organism Klebsiella pneumoniae strain DJ isolate DJ

Toxin (Protein)


Gene name ccdB Uniprot ID V5RNQ6
Locus tag LRA90_RS27575 Protein ID WP_015632464.1
Coordinates 45010..45315 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V5RQR8
Locus tag LRA90_RS27580 Protein ID WP_015632465.1
Coordinates 45315..45533 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRA90_RS27530 40040..40468 - 429 WP_015632456.1 plasmid partitioning/stability family protein -
LRA90_RS27535 40461..41441 - 981 WP_015632457.1 plasmid segregation protein ParM -
LRA90_RS27540 41802..41984 + 183 WP_015632458.1 type II toxin-antitoxin system HicA family toxin -
LRA90_RS27545 42010..42453 + 444 WP_015632459.1 type II toxin-antitoxin system HicB family antitoxin -
LRA90_RS27550 42659..42781 - 123 Protein_49 transcriptional regulator -
LRA90_RS27555 42795..43022 - 228 WP_016162072.1 hypothetical protein -
LRA90_RS27560 43254..43709 + 456 WP_015632461.1 helix-turn-helix domain-containing protein -
LRA90_RS27565 43961..44056 - 96 Protein_52 IS1 family transposase -
LRA90_RS27570 44521..44898 - 378 WP_016162069.1 hypothetical protein -
LRA90_RS27575 45010..45315 - 306 WP_015632464.1 type II toxin-antitoxin system toxin CcdB Toxin
LRA90_RS27580 45315..45533 - 219 WP_015632465.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
LRA90_RS27585 45719..46744 + 1026 WP_015632466.1 IS110 family transposase -
LRA90_RS27590 47039..47524 + 486 Protein_57 IS5 family transposase -
LRA90_RS27595 47688..48119 + 432 WP_015632467.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
LRA90_RS27600 48119..49390 + 1272 WP_016162068.1 Y-family DNA polymerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtF / ARR-3 - 1..123022 123022


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11361.90 Da        Isoelectric Point: 5.5252

>T294990 WP_015632464.1 NZ_OV049814:c45315-45010 [Klebsiella pneumoniae]
MQFTVYEYTRESHYRLFVDVQSDIVETPGRRIVIPLLESHHLSEKVNQQLFPVVSVNGKEYRAVTSELSGVSVSVIGDAV
ADLSHEANAIKNALNLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8194.13 Da        Isoelectric Point: 6.2224

>AT294990 WP_015632465.1 NZ_OV049814:c45533-45315 [Klebsiella pneumoniae]
MKHRASVTVDKEHYLELLAAGVNISGLVNEAIGREARRIQAERWKAENREGMEEVANFIAQHGSFADENRSW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0ND19

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0L1T7

References