Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3699315..3700051 | Replicon | chromosome |
| Accession | NZ_OV049808 | ||
| Organism | Klebsiella pneumoniae strain DJ isolate DJ | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | LRA90_RS18040 | Protein ID | WP_032433360.1 |
| Coordinates | 3699569..3700051 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | LRA90_RS18035 | Protein ID | WP_003026799.1 |
| Coordinates | 3699315..3699581 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRA90_RS18010 (3694961) | 3694961..3696100 | + | 1140 | WP_230633508.1 | mannitol dehydrogenase | - |
| LRA90_RS18015 (3696129) | 3696129..3696791 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| LRA90_RS18020 (3696775) | 3696775..3697779 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| LRA90_RS18025 (3697797) | 3697797..3698429 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| LRA90_RS18030 (3698439) | 3698439..3699002 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| LRA90_RS18035 (3699315) | 3699315..3699581 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| LRA90_RS18040 (3699569) | 3699569..3700051 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| LRA90_RS18045 (3700412) | 3700412..3700960 | - | 549 | WP_230633509.1 | helix-turn-helix transcriptional regulator | - |
| LRA90_RS18050 (3701222) | 3701222..3702166 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| LRA90_RS18055 (3702178) | 3702178..3702756 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| LRA90_RS18060 (3702760) | 3702760..3703500 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3669538..3710991 | 41453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T294983 WP_032433360.1 NZ_OV049808:3699569-3700051 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |