Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3682624..3683267 | Replicon | chromosome |
| Accession | NZ_OV049808 | ||
| Organism | Klebsiella pneumoniae strain DJ isolate DJ | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | LRA90_RS17945 | Protein ID | WP_032433387.1 |
| Coordinates | 3682851..3683267 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | LRA90_RS17940 | Protein ID | WP_001261276.1 |
| Coordinates | 3682624..3682854 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRA90_RS17925 (3677646) | 3677646..3678733 | + | 1088 | Protein_3480 | transcriptional regulator | - |
| LRA90_RS17930 (3678736) | 3678736..3680976 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| LRA90_RS17935 (3681504) | 3681504..3682319 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| LRA90_RS17940 (3682624) | 3682624..3682854 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LRA90_RS17945 (3682851) | 3682851..3683267 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LRA90_RS17950 (3683423) | 3683423..3684403 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| LRA90_RS17955 (3684598) | 3684598..3686169 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
| LRA90_RS17960 (3686488) | 3686488..3686736 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| LRA90_RS17965 (3686795) | 3686795..3687313 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| LRA90_RS17970 (3687344) | 3687344..3687835 | + | 492 | WP_032433378.1 | hypothetical protein | - |
| LRA90_RS17975 (3687895) | 3687895..3688098 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3669538..3710991 | 41453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T294982 WP_032433387.1 NZ_OV049808:3682851-3683267 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |