Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3022420..3023077 | Replicon | chromosome |
Accession | NZ_OV049808 | ||
Organism | Klebsiella pneumoniae strain DJ isolate DJ |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | LRA90_RS14690 | Protein ID | WP_002916310.1 |
Coordinates | 3022667..3023077 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | LRA90_RS14685 | Protein ID | WP_002916312.1 |
Coordinates | 3022420..3022686 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LRA90_RS14660 (3017576) | 3017576..3019009 | - | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
LRA90_RS14665 (3019128) | 3019128..3019856 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
LRA90_RS14670 (3019906) | 3019906..3020217 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
LRA90_RS14675 (3020381) | 3020381..3021040 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
LRA90_RS14680 (3021191) | 3021191..3022174 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
LRA90_RS14685 (3022420) | 3022420..3022686 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
LRA90_RS14690 (3022667) | 3022667..3023077 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
LRA90_RS14695 (3023084) | 3023084..3023605 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
LRA90_RS14700 (3023706) | 3023706..3024602 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
LRA90_RS14705 (3024625) | 3024625..3025338 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LRA90_RS14710 (3025344) | 3025344..3027077 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T294981 WP_002916310.1 NZ_OV049808:3022667-3023077 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |