Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 870883..871502 Replicon chromosome
Accession NZ_OV049808
Organism Klebsiella pneumoniae strain DJ isolate DJ

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LRA90_RS04160 Protein ID WP_002892050.1
Coordinates 871284..871502 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LRA90_RS04155 Protein ID WP_002892066.1
Coordinates 870883..871257 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRA90_RS04145 (866035) 866035..867228 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LRA90_RS04150 (867251) 867251..870397 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LRA90_RS04155 (870883) 870883..871257 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LRA90_RS04160 (871284) 871284..871502 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LRA90_RS04165 (871665) 871665..872231 + 567 WP_002892030.1 maltose O-acetyltransferase -
LRA90_RS04170 (872203) 872203..872343 - 141 WP_004147370.1 hypothetical protein -
LRA90_RS04175 (872364) 872364..872834 + 471 WP_020802585.1 YlaC family protein -
LRA90_RS04180 (872809) 872809..874260 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
LRA90_RS04185 (874361) 874361..875059 + 699 WP_023287311.1 GNAT family protein -
LRA90_RS04190 (875056) 875056..875196 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LRA90_RS04195 (875196) 875196..875459 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T294975 WP_002892050.1 NZ_OV049808:871284-871502 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT294975 WP_002892066.1 NZ_OV049808:870883-871257 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References