Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1673374..1673963 | Replicon | chromosome |
Accession | NZ_OV040719 | ||
Organism | Haemophilus influenzae strain 3655 isolate 3655 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q4QL51 |
Locus tag | LSO74_RS08440 | Protein ID | WP_005653200.1 |
Coordinates | 1673715..1673963 (-) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q4QL50 |
Locus tag | LSO74_RS08435 | Protein ID | WP_005653201.1 |
Coordinates | 1673374..1673718 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSO74_RS08420 (KRLU3655_LOCUS1593) | 1668597..1669991 | - | 1395 | WP_005657016.1 | sodium-coupled multidrug efflux MATE transporter HmrM | - |
LSO74_RS08425 (KRLU3655_LOCUS1594) | 1670035..1670649 | + | 615 | WP_005657019.1 | riboflavin synthase | - |
LSO74_RS08430 (KRLU3655_LOCUS1595) | 1670721..1673330 | - | 2610 | WP_005657022.1 | aminopeptidase N | - |
LSO74_RS08435 (KRLU3655_LOCUS1596) | 1673374..1673718 | - | 345 | WP_005653201.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LSO74_RS08440 (KRLU3655_LOCUS1597) | 1673715..1673963 | - | 249 | WP_005653200.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LSO74_RS08445 (KRLU3655_LOCUS1598) | 1674382..1674876 | + | 495 | WP_005653194.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
LSO74_RS08450 (KRLU3655_LOCUS1599) | 1674946..1676034 | + | 1089 | WP_005657028.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
LSO74_RS08455 (KRLU3655_LOCUS1600) | 1676174..1677364 | + | 1191 | WP_005657030.1 | amino acid aminotransferase | - |
LSO74_RS08460 | 1677449..1677576 | - | 128 | Protein_1619 | hydrogenase expression/formation protein HypE | - |
LSO74_RS08465 (KRLU3655_LOCUS1601) | 1677586..1678203 | - | 618 | WP_005657032.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
LSO74_RS08470 (KRLU3655_LOCUS1602) | 1678205..1678837 | - | 633 | WP_005657034.1 | energy-coupling factor transporter transmembrane component T | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9425.93 Da Isoelectric Point: 10.4673
>T294974 WP_005653200.1 NZ_OV040719:c1673963-1673715 [Haemophilus influenzae]
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
Download Length: 249 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 13142.04 Da Isoelectric Point: 4.8151
>AT294974 WP_005653201.1 NZ_OV040719:c1673718-1673374 [Haemophilus influenzae]
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M6BP03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M1GMF9 |