Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 764865..765502 | Replicon | chromosome |
Accession | NZ_OV040719 | ||
Organism | Haemophilus influenzae strain 3655 isolate 3655 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | A0A0H3PFA4 |
Locus tag | LSO74_RS04020 | Protein ID | WP_005656317.1 |
Coordinates | 764865..765269 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
Locus tag | LSO74_RS04025 | Protein ID | WP_005656316.1 |
Coordinates | 765266..765502 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSO74_RS03990 (KRLU3655_LOCUS754) | 760426..760992 | + | 567 | WP_005544066.1 | elongation factor P | - |
LSO74_RS04000 (KRLU3655_LOCUS755) | 761340..761930 | - | 591 | WP_005656319.1 | primosomal replication protein | - |
LSO74_RS04005 (KRLU3655_LOCUS756) | 761963..763315 | - | 1353 | WP_005649062.1 | Na+/H+ antiporter family protein | - |
LSO74_RS04010 (KRLU3655_LOCUS757) | 763629..764318 | - | 690 | WP_005654067.1 | ribonuclease T | - |
LSO74_RS04015 (KRLU3655_LOCUS758) | 764392..764799 | - | 408 | WP_005656318.1 | lactoylglutathione lyase | - |
LSO74_RS04020 (KRLU3655_LOCUS759) | 764865..765269 | - | 405 | WP_005656317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LSO74_RS04025 (KRLU3655_LOCUS760) | 765266..765502 | - | 237 | WP_005656316.1 | antitoxin | Antitoxin |
LSO74_RS04030 (KRLU3655_LOCUS761) | 765595..766320 | - | 726 | WP_005656315.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
LSO74_RS04035 (KRLU3655_LOCUS762) | 766373..766891 | - | 519 | WP_005656314.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
LSO74_RS04040 (KRLU3655_LOCUS763) | 767110..768876 | + | 1767 | WP_005656313.1 | aspartate--tRNA ligase | - |
LSO74_RS04045 (KRLU3655_LOCUS764) | 768898..769374 | + | 477 | WP_005656312.1 | dihydroneopterin triphosphate diphosphatase | - |
LSO74_RS04050 (KRLU3655_LOCUS765) | 769534..770274 | + | 741 | WP_005649034.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15660.23 Da Isoelectric Point: 8.9777
>T294972 WP_005656317.1 NZ_OV040719:c765269-764865 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFLTYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFLTYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PFA4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PN67 |