Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 74878..75412 | Replicon | chromosome |
Accession | NZ_OV040719 | ||
Organism | Haemophilus influenzae strain 3655 isolate 3655 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0H3PGA1 |
Locus tag | LSO74_RS00370 | Protein ID | WP_005655869.1 |
Coordinates | 75122..75412 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0H3PEU6 |
Locus tag | LSO74_RS00365 | Protein ID | WP_005655871.1 |
Coordinates | 74878..75132 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSO74_RS00330 (KRLU3655_LOCUS66) | 69945..70310 | + | 366 | WP_005655888.1 | endonuclease domain-containing protein | - |
LSO74_RS00335 (KRLU3655_LOCUS67) | 70450..70866 | + | 417 | WP_005655886.1 | hypothetical protein | - |
LSO74_RS00340 (KRLU3655_LOCUS68) | 70912..72978 | + | 2067 | WP_005655883.1 | glycine--tRNA ligase subunit beta | - |
LSO74_RS00350 (KRLU3655_LOCUS69) | 73339..74010 | + | 672 | WP_005655881.1 | integrase arm-type DNA-binding domain-containing protein | - |
LSO74_RS00355 (KRLU3655_LOCUS70) | 74040..74348 | + | 309 | WP_005655879.1 | P2 family phage major capsid protein | - |
LSO74_RS00360 (KRLU3655_LOCUS72) | 74581..74787 | + | 207 | WP_005655873.1 | hypothetical protein | - |
LSO74_RS00365 (KRLU3655_LOCUS73) | 74878..75132 | + | 255 | WP_005655871.1 | stability protein StbD | Antitoxin |
LSO74_RS00370 (KRLU3655_LOCUS74) | 75122..75412 | + | 291 | WP_005655869.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LSO74_RS00375 (KRLU3655_LOCUS75) | 75629..75853 | + | 225 | WP_005655867.1 | hypothetical protein | - |
LSO74_RS00380 (KRLU3655_LOCUS76) | 76322..77356 | - | 1035 | WP_005655864.1 | DNA polymerase III subunit delta | - |
LSO74_RS00385 (KRLU3655_LOCUS77) | 77356..77859 | - | 504 | WP_005651506.1 | LPS assembly lipoprotein LptE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11510.47 Da Isoelectric Point: 10.6484
>T294969 WP_005655869.1 NZ_OV040719:75122-75412 [Haemophilus influenzae]
MTYKLIFDKRALKEWNKLGETLRQQFKNKLVERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
MTYKLIFDKRALKEWNKLGETLRQQFKNKLVERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PGA1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PEU6 |