Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 46070..46701 | Replicon | chromosome |
Accession | NZ_OV040584 | ||
Organism | Haemophilus influenzae isolate KR271 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q4QLW0 |
Locus tag | LSO75_RS00220 | Protein ID | WP_005651560.1 |
Coordinates | 46303..46701 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q4QLV9 |
Locus tag | LSO75_RS00215 | Protein ID | WP_005648011.1 |
Coordinates | 46070..46303 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LSO75_RS00190 (KRLU271_LOCUS39) | 41550..42752 | - | 1203 | WP_011272308.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
LSO75_RS00195 (KRLU271_LOCUS40) | 42915..43580 | + | 666 | WP_013526173.1 | DNA repair protein RadC | - |
LSO75_RS00200 (KRLU271_LOCUS41) | 43794..44030 | + | 237 | WP_005542826.1 | 50S ribosomal protein L28 | - |
LSO75_RS00205 (KRLU271_LOCUS42) | 44042..44212 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
LSO75_RS00210 (KRLU271_LOCUS43) | 44559..45923 | + | 1365 | WP_044364467.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
LSO75_RS00215 (KRLU271_LOCUS44) | 46070..46303 | + | 234 | WP_005648011.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
LSO75_RS00220 (KRLU271_LOCUS45) | 46303..46701 | + | 399 | WP_005651560.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
LSO75_RS00225 (KRLU271_LOCUS46) | 46721..48256 | + | 1536 | WP_044364470.1 | L-2,4-diaminobutyrate decarboxylase | - |
LSO75_RS00230 (KRLU271_LOCUS47) | 48487..49302 | + | 816 | WP_044364472.1 | DNA-formamidopyrimidine glycosylase | - |
LSO75_RS00235 (KRLU271_LOCUS48) | 49376..50398 | - | 1023 | WP_005651554.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
LSO75_RS00240 (KRLU271_LOCUS49) | 50399..51517 | - | 1119 | WP_005686201.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15115.46 Da Isoelectric Point: 8.0514
>T294962 WP_005651560.1 NZ_OV040584:46303-46701 [Haemophilus influenzae]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QLW0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806DGS0 |