Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/VapC(toxin) |
| Location | 1170270..1170904 | Replicon | chromosome |
| Accession | NZ_OV024757 | ||
| Organism | Deinococcus radiodurans isolate DRR11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q9RX96 |
| Locus tag | M7777_RS06065 | Protein ID | WP_010887064.1 |
| Coordinates | 1170491..1170904 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M7777_RS06060 | Protein ID | WP_162177573.1 |
| Coordinates | 1170270..1170494 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7777_RS06025 | 1165420..1166103 | + | 684 | WP_010887056.1 | SDR family oxidoreductase | - |
| M7777_RS06030 | 1166124..1167086 | + | 963 | WP_034349507.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| M7777_RS06035 | 1167109..1167288 | + | 180 | WP_034349506.1 | hypothetical protein | - |
| M7777_RS06040 | 1167290..1167919 | + | 630 | WP_027479568.1 | HAD family hydrolase | - |
| M7777_RS06045 | 1167967..1169487 | - | 1521 | WP_010887060.1 | carboxylesterase/lipase family protein | - |
| M7777_RS06050 | 1169628..1169870 | + | 243 | WP_010887061.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| M7777_RS06055 | 1169864..1170217 | + | 354 | WP_010887062.1 | endoribonuclease MazF | - |
| M7777_RS06060 | 1170270..1170494 | + | 225 | WP_162177573.1 | hypothetical protein | Antitoxin |
| M7777_RS06065 | 1170491..1170904 | + | 414 | WP_010887064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M7777_RS06070 | 1170901..1173368 | + | 2468 | Protein_1176 | ATP-dependent helicase HrpB | - |
| M7777_RS06075 | 1173564..1174796 | + | 1233 | WP_063653036.1 | transposase | - |
| M7777_RS06080 | 1174878..1175102 | - | 225 | WP_162177572.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1173564..1174796 | 1232 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14634.68 Da Isoelectric Point: 5.5820
>T294961 WP_010887064.1 NZ_OV024757:1170491-1170904 [Deinococcus radiodurans]
MTESTVLDANILSALLRSEANPLSIARQLSALAREGSLVVYAELLAGPEVTPDFLKGFLQEVDVQILPPSGLAVWESAGL
AYGSYAQRRQRSGGGSPRQILSDFVIGAHALYHGAALFTADPQHYRLSFPALTVLTP
MTESTVLDANILSALLRSEANPLSIARQLSALAREGSLVVYAELLAGPEVTPDFLKGFLQEVDVQILPPSGLAVWESAGL
AYGSYAQRRQRSGGGSPRQILSDFVIGAHALYHGAALFTADPQHYRLSFPALTVLTP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|