Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3682475..3683095 | Replicon | chromosome |
Accession | NZ_OU963893 | ||
Organism | Unidentified bacterial endosymbiont isolate Enterobacter_chilo |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | NL510_RS17670 | Protein ID | WP_253378797.1 |
Coordinates | 3682877..3683095 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NL510_RS17665 | Protein ID | WP_253378795.1 |
Coordinates | 3682475..3682849 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL510_RS17655 | 3677599..3678792 | + | 1194 | WP_253378793.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL510_RS17660 | 3678815..3681962 | + | 3148 | Protein_3451 | multidrug efflux RND transporter permease subunit AcrB | - |
NL510_RS17665 | 3682475..3682849 | + | 375 | WP_253378795.1 | Hha toxicity modulator TomB | Antitoxin |
NL510_RS17670 | 3682877..3683095 | + | 219 | WP_253378797.1 | HHA domain-containing protein | Toxin |
NL510_RS17675 | 3683303..3683854 | + | 552 | WP_253378799.1 | maltose O-acetyltransferase | - |
NL510_RS17680 | 3683972..3684439 | + | 468 | WP_253378801.1 | YlaC family protein | - |
NL510_RS17685 | 3684483..3684623 | - | 141 | WP_253378803.1 | type B 50S ribosomal protein L36 | - |
NL510_RS17690 | 3684626..3684886 | - | 261 | WP_253378805.1 | type B 50S ribosomal protein L31 | - |
NL510_RS17695 | 3685120..3686688 | + | 1569 | WP_253378808.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8607.99 Da Isoelectric Point: 8.9008
>T294958 WP_253378797.1 NZ_OU963893:3682877-3683095 [unidentified bacterial endosymbiont]
MTEKPLTKIDYLLRLRRCQSLDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MTEKPLTKIDYLLRLRRCQSLDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT294958 WP_253378795.1 NZ_OU963893:3682475-3682849 [unidentified bacterial endosymbiont]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINVQDLQKWRKSGNRLFRCFVNASRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINVQDLQKWRKSGNRLFRCFVNASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|